DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klg and dpr14

DIOPT Version :9

Sequence 1:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster


Alignment Length:289 Identity:69/289 - (23%)
Similarity:97/289 - (33%) Gaps:80/289 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LGWL-------LHAHAGSGGFAVEAAISNRGSN------------SRSMSNVQQSAVAASTLTAT 99
            |.|:       || |.|||..:........|..            |...::..:......|.|.|
  Fly     5 LFWILAIIYSSLH-HIGSGSTSTTLKRPRAGDPFDTFPKNFWQEFSSPFTDTPEDEELEVTETTT 68

  Fly   100 LPRFLSRGHTYRAV-----VGDTLVLPCQVENLGNFVLLW--RRGTN--VLTASNIMVTRDERVR 155
            ...|......|..:     :..::.|.|:|.:|....:.|  |||.:  ::|......:.|.|  
  Fly    69 HEPFPFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSR-- 131

  Fly   156 LIDGYNLEISDLEP------------QDAGDYVCQISDKINRDQVHTVEIL------VPPSVRAI 202
                |:||..  ||            :|.|.|.||:|.       |...:|      :.|.|..:
  Fly   132 ----YSLEFE--EPNDWKLLIQFANERDEGPYECQVSS-------HPPLVLLVYLTIIVPHVEIL 183

  Fly   203 PTSGQLQARK----GGPITLECKGSGNPVPSIYWTKKSG---ANKSTARIGDG------PILTLE 254
            ...|.....|    |..|.|:|..|..|.||.|.|.:.|   .|..|:|.|..      |...|.
  Fly   184 DERGSATPEKYYKAGSTIELQCVISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPGRALS 248

  Fly   255 KL-----ERQQAGVYQCTADNGVGDPVTV 278
            :|     .||..|.|.|...|.:.:.|.|
  Fly   249 RLYIANANRQDTGNYTCMLGNEITETVVV 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518 12/77 (16%)
IG_like 109..195 CDD:214653 25/112 (22%)
Ig 118..191 CDD:143165 23/88 (26%)
IG_like 205..274 CDD:214653 26/86 (30%)
IGc2 213..273 CDD:197706 24/73 (33%)
IGc2 301..367 CDD:197706
FN3 392..486 CDD:238020
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 21/87 (24%)
Ig 84..169 CDD:299845 23/99 (23%)
IG_like 191..279 CDD:214653 27/87 (31%)
Ig 201..274 CDD:143165 23/72 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.