DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klg and Cntn6

DIOPT Version :10

Sequence 1:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_037357.1 Gene:Cntn6 / 27256 RGDID:62008 Length:1028 Species:Rattus norvegicus


Alignment Length:603 Identity:112/603 - (18%)
Similarity:185/603 - (30%) Gaps:238/603 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 GDTLVLPC-QVENLGNFVLLWRRGTNVLTASNIMVTRDERVRLI--DGYNLEISDLEPQDAGDYV 176
            |..:||.| ...:.|.....|....|.|     .|..|:| |.:  :..||.|:.:||.|.|:|.
  Rat   137 GQGVVLLCGPPPHFGELSYDWTFNDNPL-----YVQEDKR-RFVSQNTGNLYIAKVEPSDVGNYT 195

  Fly   177 CQISDKINRDQVHTVEILVPPSVRAIPTSG---------------QLQARKGGPITLECKGSGNP 226
            |.:::|    :.|. .:..||:.....|.|               .:||.|...:.|||...|||
  Rat   196 CFVTNK----EAHR-SVQGPPTPLVQRTDGVMGEYEPKIEVRFPETIQAAKDSSVKLECFALGNP 255

  Fly   227 VPSIYWTKKSGA--------NKSTARIGDGPILTLEKLERQQAGVYQCTADNGVGDPVTVDMRLD 283
            ||.|.|.:..|:        :.|.|      .|.:.|.:::..|.|:|.|.|..|..:.....  
  Rat   256 VPDISWRRLDGSPMPGKVKYSNSQA------TLEIPKFQQEDEGFYECVAGNLRGRNLAKGQL-- 312

  Fly   284 VLYPPDIQVEK--------------------------SWIHSGE--------------------- 301
            :.|.|....:|                          :|:.:||                     
  Rat   313 IFYAPPEWEQKIQNTYLSIYDSLFWECKASGNPNPSYTWLKNGERLNTEERIQTENGTLIITMLN 377

  Fly   302 ----------------------------------------------GFEAKLVCIVFADPVATVS 320
                                                          |.:..:.|...|.|.|::|
  Rat   378 VSDSGIYQCAAENKYQTIYANAELRVLASAPDFSKNPIKKISVVQVGGDISIECKPNAFPKASIS 442

  Fly   321 WYQNSFPIQSTDRRIMATRANRHMLTIRHIQQEDFGNYSCVADNSLGRSRKYMELSGRPGAAEFY 385
            |.:.:..::.:.|.......:   |.|.::.:.|.|:|:|||.|..|..:....|..:.......
  Rat   443 WKRGTENLKQSKRVFFLEDGS---LKICNVTRSDAGSYTCVATNQFGNGKSSGSLIVKERTVITV 504

  Fly   386 SPKWGRSPDSYNLTWKID-------------SYPPLEEV-------------------------- 411
            .|.            |:|             |:.|..||                          
  Rat   505 PPS------------KMDVTVGESIVLPCQVSHDPTMEVLFVWYFNGDVIDLKKGVAHFERIGGE 557

  Fly   412 ---RLLYRRVQMNE----------TYQQPGRWHDFILT-PEHRPASEPLTHIMSYTIK-NLHPGG 461
               .|:.|.:|:..          |.::.....|.|:. |...|....:.||.|.|.: :..||.
  Rat   558 SVGDLMIRNIQLGHSGKYLCTVQTTLERLSAVADIIVRGPPGPPEDVKVEHISSTTSQLSWRPGP 622

  Fly   462 YYEA-----IVQAKNRY--GWNEVSDI---------------------FQF-VVATNSQDIG--P 495
            ...:     .:|.:..:  ||..|:.:                     ::| |||.|:..||  .
  Rat   623 DNNSPIQIFTIQTRTPFSVGWQAVATVPEILNGQTYNATVIGLSPWVEYEFRVVAGNNIGIGEPS 687

  Fly   496 EDAEVVASSKSRSNSASI 513
            :.:|::.:..|..|.|.:
  Rat   688 KPSELLRTKASIPNVAPV 705

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 IG_like 109..195 CDD:214653 23/82 (28%)
Ig strand B 118..122 CDD:409353 2/3 (67%)
Ig strand C 131..135 CDD:409353 0/3 (0%)
Ig strand E 160..164 CDD:409353 2/3 (67%)
Ig strand F 174..179 CDD:409353 2/4 (50%)
Ig strand G 188..191 CDD:409353 1/2 (50%)
Ig_3 196..270 CDD:464046 26/96 (27%)
Ig_3 287..364 CDD:464046 21/169 (12%)
FN3 392..486 CDD:238020 25/176 (14%)
Cntn6NP_037357.1 Ig 26..120 CDD:472250
Ig strand B 46..50 CDD:409353
Ig strand C 59..63 CDD:409353
Ig strand E 82..86 CDD:409353
Ig strand F 97..102 CDD:409353
Ig strand G 111..114 CDD:409353
Ig 129..214 CDD:472250 25/87 (29%)
Ig strand B 140..144 CDD:409353 2/3 (67%)
Ig strand C 154..158 CDD:409353 0/3 (0%)
Ig strand E 179..183 CDD:409353 2/3 (67%)
Ig strand F 193..198 CDD:409353 2/4 (50%)
Ig strand G 209..212 CDD:409353 1/2 (50%)
Ig 227..315 CDD:472250 24/95 (25%)
Ig strand B 245..249 CDD:409353 1/3 (33%)
Ig strand C 258..262 CDD:409353 1/3 (33%)
Ig strand E 280..284 CDD:409353 2/9 (22%)
Ig strand F 294..299 CDD:409353 2/4 (50%)
Ig strand G 307..310 CDD:409353 0/2 (0%)
Ig 319..403 CDD:472250 4/83 (5%)
Ig strand B 335..339 CDD:143205 0/3 (0%)
Ig strand C 348..352 CDD:143205 0/3 (0%)
Ig strand E 369..373 CDD:143205 0/3 (0%)
Ig strand F 383..388 CDD:143205 0/4 (0%)
Ig strand G 396..399 CDD:143205 0/2 (0%)
Ig5_Contactin 408..496 CDD:409358 19/90 (21%)
Ig strand A 408..413 CDD:409358 0/4 (0%)
Ig strand A' 416..421 CDD:409358 0/4 (0%)
Ig strand B 425..432 CDD:409358 0/6 (0%)
Ig strand C 440..444 CDD:409358 1/3 (33%)
Ig strand D 458..461 CDD:409358 0/2 (0%)
Ig strand E 462..467 CDD:409358 1/7 (14%)
Ig strand F 475..483 CDD:409358 5/7 (71%)
Ig strand G 489..496 CDD:409358 1/6 (17%)
Ig 500..598 CDD:472250 13/109 (12%)
Ig strand B 517..521 CDD:409353 0/3 (0%)
Ig strand C 532..536 CDD:409353 0/3 (0%)
Ig strand E 560..564 CDD:409353 1/3 (33%)
Ig strand F 574..579 CDD:409353 0/4 (0%)
Ig strand G 587..590 CDD:409353 0/2 (0%)
FN3 598..691 CDD:238020 18/92 (20%)
FN3 <620..>912 CDD:442628 17/86 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 887..908
FN3 903..983 CDD:214495
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.