DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klg and Cntn5

DIOPT Version :10

Sequence 1:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:XP_036010831.1 Gene:Cntn5 / 244682 MGIID:3042287 Length:1434 Species:Mus musculus


Alignment Length:351 Identity:89/351 - (25%)
Similarity:133/351 - (37%) Gaps:65/351 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 SNVQQSAVAASTLTATLPRFLSR-------------GHTYRAV---VGDTLVLPCQ-VENLGNFV 131
            |.::.|.:.....|.:....|||             |.|..||   .|..:||.|. ..:....:
Mouse   469 SELRDSGLYQCLATNSFGSILSREATLQFAYLGNFSGRTRSAVSVREGQGVVLMCSPPPHSPEII 533

  Fly   132 LLWRRGTNVLTASNIMVTRDERVRLI--DGYNLEISDLEPQDAGDYVCQISDKINRDQVHTVEIL 194
            ..|     |.......|..|.| |.|  :..||.||.::..|.|.|:|.:     ::.|....:|
Mouse   534 YSW-----VFNEFPSFVAEDSR-RFISQETGNLYISKVQTSDVGSYICLV-----KNAVTNARVL 587

  Fly   195 VPPSVRAIPTSG---------------QLQARKGGPITLECKGSGNPVPSIYWTKKSGANKSTAR 244
            .||:...:...|               .:.|.||..:.:||...|||||:|.|.|.:|...|.:|
Mouse   588 SPPTPLTLRNDGVMGEYEPKIEVHFPFTVTAAKGTTVKMECFALGNPVPTITWMKVNGYIPSKSR 652

  Fly   245 IGDG-PILTLEKLERQQAGVYQCTADNGVGDPVTVDMRLDVLYPPDIQ-VEKSWIHSGEGFEAKL 307
            :... .:|.:..|:...||:|:|||:|..|............||..:| :..:.:.||...:.: 
Mouse   653 LRKSQAVLEIPNLQLDDAGIYECTAENSRGKNSFRGQLQIFTYPHWVQKLNDTQLDSGSPLQWE- 716

  Fly   308 VCIVFADPVATVSWYQNSFPIQSTDRRIMATRANRHMLTIRHIQQEDFGNYSCVADNSLGRSRKY 372
             |.....|..|..|.:|..|:....|    ......:|.|:.:.|.|.|.|.|:|:|..|.....
Mouse   717 -CKATGKPRPTYRWLKNGAPLLPQSR----VDTVNGILAIQSVNQSDAGMYQCLAENKYGAIYAS 776

  Fly   373 MELSGRPGAAEFYSPKWGRSPDSYNL 398
            .||            |...||.|:.|
Mouse   777 AEL------------KILASPPSFEL 790

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 IG_like 109..195 CDD:214653 23/91 (25%)
Ig strand B 118..122 CDD:409353 2/3 (67%)
Ig strand C 131..135 CDD:409353 0/3 (0%)
Ig strand E 160..164 CDD:409353 2/3 (67%)
Ig strand F 174..179 CDD:409353 2/4 (50%)
Ig strand G 188..191 CDD:409353 1/2 (50%)
Ig_3 196..270 CDD:464046 27/89 (30%)
Ig_3 287..364 CDD:464046 19/77 (25%)
FN3 392..486 CDD:238020 4/7 (57%)
Cntn5XP_036010831.1 Integrase_Zn 28..63 CDD:426567
rve 79..172 CDD:459897
IN_DBD_C 243..288 CDD:425747
Ig 404..499 CDD:472250 6/29 (21%)
Ig strand B 425..429 CDD:409353
Ig strand C 438..442 CDD:409353
Ig strand E 461..465 CDD:409353
Ig strand F 476..481 CDD:409353 0/4 (0%)
Ig strand G 490..493 CDD:409353 2/2 (100%)
Ig 508..593 CDD:472250 25/95 (26%)
Ig strand B 519..523 CDD:409353 2/3 (67%)
Ig strand C 533..537 CDD:409353 1/8 (13%)
Ig strand E 558..562 CDD:409353 2/3 (67%)
Ig strand F 572..577 CDD:409353 2/4 (50%)
Ig strand G 588..591 CDD:409353 1/2 (50%)
Ig 606..693 CDD:472250 26/86 (30%)
Ig strand B 624..628 CDD:409353 0/3 (0%)
Ig strand C 637..641 CDD:409353 1/3 (33%)
Ig strand E 658..662 CDD:409353 1/3 (33%)
Ig strand F 672..677 CDD:409353 2/4 (50%)
Ig strand G 685..688 CDD:409353 0/2 (0%)
Ig 698..781 CDD:472250 22/100 (22%)
Ig strand B 713..717 CDD:409353 0/5 (0%)
Ig strand C 726..730 CDD:409353 1/3 (33%)
Ig strand E 747..751 CDD:409353 1/3 (33%)
Ig strand F 761..766 CDD:409353 2/4 (50%)
Ig strand G 774..777 CDD:409353 0/2 (0%)
Ig 786..903 CDD:472250 2/5 (40%)
Ig strand B 805..809 CDD:409353
Ig strand C 818..822 CDD:409353
Ig strand E 869..873 CDD:409353
Ig strand F 883..888 CDD:409353
Ig strand G 896..899 CDD:409353
Ig 905..1006 CDD:472250
Ig strand B 924..928 CDD:409353
Ig strand C 939..943 CDD:409353
Ig strand E 968..972 CDD:409353
Ig strand F 982..987 CDD:409353
Ig strand G 995..998 CDD:409353
FN3 1006..1103 CDD:238020
FN3 <1018..1414 CDD:442628
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.