DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klg and Ntm

DIOPT Version :10

Sequence 1:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001344522.1 Gene:Ntm / 235106 MGIID:2446259 Length:367 Species:Mus musculus


Alignment Length:286 Identity:81/286 - (28%)
Similarity:135/286 - (47%) Gaps:31/286 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 ATLPRFLSRGHTYRAVVGDTLVLPCQVENLGNFVLLWRRGTNVLTASNIMVTRDERVRLIDG--- 159
            ||.|:.:. ..|.|.  |::..|.|.::|....| .|...:.:|.|.|.....|.||.|:..   
Mouse    36 ATFPKAMD-NVTVRQ--GESATLRCTIDNRVTRV-AWLNRSTILYAGNDKWCLDPRVVLLSNTQT 96

  Fly   160 -YNLEISDLEPQDAGDYVCQISDKINRDQVHTVEILVPPSVRAIPTSGQLQARKGGPITLECKGS 223
             |::||.:::..|.|.|.|.:... |..:...|.::|..|.:.:..|..:...:|..|:|.|..:
Mouse    97 QYSIEIQNVDVYDEGPYTCSVQTD-NHPKTSRVHLIVQVSPKIVEISSDISINEGNNISLTCIAT 160

  Fly   224 GNPVPSIYWTKKSGANKSTARIGDGPILTLEKLERQQAGVYQCTADNGVGDPVTVDMRLDVLYPP 288
            |.|.|::.|...|  .|:...:.:...|.::.:.|:|:|.|:|:|.|.|..||...:::.|.|||
Mouse   161 GRPEPTVTWRHIS--PKAVGFVSEDEYLEIQGITREQSGEYECSASNDVAAPVVRRVKVTVNYPP 223

  Fly   289 DIQVEKSWIHSG--EGFEAKLVCIVFADPVATVSWYQNSFPIQSTDRRIMATR-----ANR---H 343
            .|...|.   :|  .|.:..|.|...|.|.|...|:::       |:|::..:     .||   .
Mouse   224 YISEAKG---TGVPVGQKGTLQCEASAVPSAEFQWFKD-------DKRLVEGKKGVKVENRPFLS 278

  Fly   344 MLTIRHIQQEDFGNYSCVADNSLGRS 369
            .||..::.:.|:|||:|||.|.||.:
Mouse   279 KLTFFNVSEHDYGNYTCVASNKLGHT 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 IG_like 109..195 CDD:214653 24/89 (27%)
Ig strand B 118..122 CDD:409353 1/3 (33%)
Ig strand C 131..135 CDD:409353 1/3 (33%)
Ig strand E 160..164 CDD:409353 1/3 (33%)
Ig strand F 174..179 CDD:409353 2/4 (50%)
Ig strand G 188..191 CDD:409353 0/2 (0%)
Ig_3 196..270 CDD:464046 19/73 (26%)
Ig_3 287..364 CDD:464046 25/86 (29%)
FN3 392..486 CDD:238020
NtmNP_001344522.1 Ig 44..132 CDD:472250 24/91 (26%)
Ig strand B 53..57 CDD:409353 1/3 (33%)
Ig strand C 65..69 CDD:409353 1/4 (25%)
Ig strand E 98..102 CDD:409353 1/3 (33%)
Ig strand F 112..117 CDD:409353 2/4 (50%)
Ig strand G 125..128 CDD:409353 0/2 (0%)
Ig_3 136..205 CDD:464046 18/70 (26%)
Ig 223..307 CDD:472250 27/92 (29%)
Ig strand B 239..243 CDD:409353 1/3 (33%)
Ig strand C 252..256 CDD:409353 0/3 (0%)
Ig strand E 278..282 CDD:409353 1/3 (33%)
Ig strand F 292..297 CDD:409353 3/4 (75%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.