DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klg and Iglon5

DIOPT Version :9

Sequence 1:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001157990.1 Gene:Iglon5 / 210094 MGIID:2686277 Length:336 Species:Mus musculus


Alignment Length:349 Identity:98/349 - (28%)
Similarity:147/349 - (42%) Gaps:59/349 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LLHAHAGSGGFAVEAAISNRGSNSRSMSNVQQSAVAASTLTATLPRFLSRGHTYRAVVGDTLVLP 121
            ||.|.|.:|     .|:.:||..|:|:                  .|.|....|....||...|.
Mouse    12 LLAAAALAG-----LAVISRGLLSQSL------------------EFSSPADNYTVCEGDNATLS 53

  Fly   122 CQVENLGNFVLLWRRGTNVLTASNIMVTRDERVRLI----DGYNLEISDLEPQDAGDYVCQISDK 182
            |.::.....| .|...:|:|.|.|...|.|.||||:    :.:::.|:.:...|.|.|.|...  
Mouse    54 CFIDEHVTRV-AWLNRSNILYAGNDRWTSDPRVRLLINTPEEFSILITQVGLGDEGLYTCSFQ-- 115

  Fly   183 INRDQVHTVEI--LVPPSVRAIPTSGQLQARKGGPITLECKGSGNPVPSIYWTKKSGANKSTARI 245
             .|.|.:|.::  :|....|.:..|..:...:||.:.|.|...|.|.|::.|.:......|    
Mouse   116 -TRHQPYTTQVYLIVHVPARIVNISSPVAVNEGGNVNLLCLAVGRPEPTVTWRQLRDGFTS---- 175

  Fly   246 GDGPILTLEKLERQQAGVYQCTADNGVGD-PVTVDMRLDVLYPPDIQVEKSWIHSGEGFEAKLVC 309
             :|.||.:..::|.|||.|:|...|||.. |.:..:.:.|.|||.| .:.:...:..|..|.|.|
Mouse   176 -EGEILEISDIQRGQAGEYECVTHNGVNSAPDSRRVLVTVNYPPTI-TDVTSARTALGRAALLRC 238

  Fly   310 IVFADPVATVSWYQNSFPIQSTDRRIMA----------TRANRHMLTIRHIQQEDFGNYSCVADN 364
            ...|.|.|...||:        |.|:::          |...|.||...::....:|||:|.|.|
Mouse   239 EAMAVPPADFQWYK--------DDRLLSSGSAEGLKVQTERTRSMLLFANVSARHYGNYTCRAAN 295

  Fly   365 SLGRSRKYMELSGRPGAAEFYSPK 388
            .||.|...|.|. |||:.|..:|:
Mouse   296 RLGASSASMRLL-RPGSLENSAPR 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518 13/60 (22%)
IG_like 109..195 CDD:214653 25/91 (27%)
Ig 118..191 CDD:143165 21/76 (28%)
IG_like 205..274 CDD:214653 22/68 (32%)
IGc2 213..273 CDD:197706 20/59 (34%)
IGc2 301..367 CDD:197706 21/75 (28%)
FN3 392..486 CDD:238020
Iglon5NP_001157990.1 Ig 41..129 CDD:416386 25/91 (27%)
Ig strand A' 41..46 CDD:409353 1/4 (25%)
Ig strand B 48..56 CDD:409353 3/7 (43%)
CDR1 56..60 CDD:409353 0/3 (0%)
FR2 61..68 CDD:409353 2/7 (29%)
Ig strand C 61..67 CDD:409353 2/6 (33%)
CDR2 69..79 CDD:409353 4/9 (44%)
Ig strand C' 71..74 CDD:409353 1/2 (50%)
Ig strand C' 76..79 CDD:409353 1/2 (50%)
FR3 80..115 CDD:409353 11/34 (32%)
Ig strand D 84..91 CDD:409353 4/6 (67%)
Ig strand E 94..100 CDD:409353 0/5 (0%)
Ig strand F 107..115 CDD:409353 3/7 (43%)
CDR3 116..120 CDD:409353 1/3 (33%)
Ig strand G 120..129 CDD:409353 1/8 (13%)
FR4 122..129 CDD:409353 1/6 (17%)
Ig strand A 132..137 CDD:409353 1/4 (25%)
Ig_3 134..199 CDD:404760 20/69 (29%)
Ig strand A' 140..145 CDD:409353 0/4 (0%)
Ig strand B 148..157 CDD:409353 3/8 (38%)
Ig strand C 163..167 CDD:409353 0/3 (0%)
Ig strand D 174..177 CDD:409353 1/7 (14%)
Ig strand E 178..183 CDD:409353 2/4 (50%)
Ig strand F 191..199 CDD:409353 3/7 (43%)
Ig_3 217..295 CDD:404760 23/86 (27%)
putative Ig strand A 218..224 CDD:409353 2/6 (33%)
Ig strand B 234..238 CDD:409353 2/3 (67%)
Ig strand C 247..251 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 2/3 (67%)
Ig strand F 288..293 CDD:409353 3/4 (75%)
Ig strand G 301..304 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833619
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.