DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klg and CADM4

DIOPT Version :10

Sequence 1:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_660339.1 Gene:CADM4 / 199731 HGNCID:30825 Length:388 Species:Homo sapiens


Alignment Length:288 Identity:68/288 - (23%)
Similarity:112/288 - (38%) Gaps:32/288 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 GDTLVLPCQVENL-GNFVLLWRRGTNVLTASNIMVTRDERVRLID----GYNLEISDLEPQDAGD 174
            |....:.|::... |:.|::.......|..:.....:|||.:|.:    ...:.:||...:|.|.
Human    37 GGVAEITCRLHQYDGSIVVIQNPARQTLFFNGTRALKDERFQLEEFSPRRVRIRLSDARLEDEGG 101

  Fly   175 YVCQISDKINRDQVHTVEILVPPSVRAIPTSGQLQARKGGPITLEC-KGSGNPVPSIYWTKK--- 235
            |.||:..:....|:.|:.:||.|....:..  :.||.:||.:.|.| .....|..::.|.:.   
Human   102 YFCQLYTEDTHHQIATLTV
LVAPENPVVEV--REQAVEGGEVELSCLVPRSRPAATLRWYRDRKE 164

  Fly   236 -SGANKSTARIGDGPILTLEKLER------QQAGVYQCTADNGV---GDPVTVDMRLDVLYPPDI 290
             .|.:.|..   :|.:.::....|      ...|:..|.|.|..   |........|||.|.|..
Human   165 LKGVSSSQE---NGKVWSVASTVRFRVDRKDDGGIIICEAQNQALPSGHSKQTQYVLDV
QYSPTA 226

  Fly   291 QVEKSWIHSGEGFEAKLVCIVFADPVAT-VSWYQNSFPIQSTDRRIMATRANRHMLTIRHIQQED 354
            ::..|.....||....|.|.|..:|... :.|.:.:   :|...|   ..|....||:..:...|
Human   227 RIHASQAVVREGDTLVLTCAVTGNPRPNQIRWNRGN---ESLPER---AEAVGETLTLPGLVSAD 285

  Fly   355 FGNYSCVADNSLGRSRK-YMELSGRPGA 381
            .|.|:|.|.|..|.:|. |:.:...|||
Human   286 NGTYTCEASNKHGHARALYVLVVYDPGA 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 IG_like 109..195 CDD:214653 18/84 (21%)
Ig strand B 118..122 CDD:409353 0/3 (0%)
Ig strand C 131..135 CDD:409353 1/3 (33%)
Ig strand E 160..164 CDD:409353 0/3 (0%)
Ig strand F 174..179 CDD:409353 2/4 (50%)
Ig strand G 188..191 CDD:409353 0/2 (0%)
Ig_3 196..270 CDD:464046 16/84 (19%)
Ig_3 287..364 CDD:464046 19/77 (25%)
FN3 392..486 CDD:238020
CADM4NP_660339.1 Ig 29..120 CDD:472250 18/82 (22%)
Ig strand B 40..44 CDD:409353 0/3 (0%)
Ig strand C 53..57 CDD:409353 1/3 (33%)
Ig strand E 87..91 CDD:409353 0/3 (0%)
Ig strand F 101..106 CDD:409353 2/4 (50%)
Ig strand G 113..116 CDD:409353 1/2 (50%)
IgI_2_Necl-4 121..220 CDD:409468 21/103 (20%)
Ig strand A 121..124 CDD:409468 2/2 (100%)
Ig strand A' 127..131 CDD:409468 0/3 (0%)
Ig strand B 139..149 CDD:409468 3/9 (33%)
Ig strand C 152..161 CDD:409468 2/8 (25%)
Ig strand C' 162..165 CDD:409468 0/2 (0%)
Ig strand D 167..174 CDD:409468 2/9 (22%)
Ig strand E 177..187 CDD:409468 1/9 (11%)
Ig strand F 195..203 CDD:409468 3/7 (43%)
Ig strand G 212..219 CDD:409468 0/6 (0%)
Ig_3 224..295 CDD:464046 19/76 (25%)
4.1m 344..362 CDD:128590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.