DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klg and zig-3

DIOPT Version :9

Sequence 1:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_509336.1 Gene:zig-3 / 192088 WormBaseID:WBGene00006980 Length:251 Species:Caenorhabditis elegans


Alignment Length:250 Identity:56/250 - (22%)
Similarity:83/250 - (33%) Gaps:75/250 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 PQDAGDYVCQISDKINRDQVHTVEILVPPSVRAIPTSGQLQARKGGPITLECKGSGNPVPSIYWT 233
            |..:|:....:|:.:.  ::.:..:...||::.|..........|..:||.|.....|...||| 
 Worm    16 PLSSGEMRAAVSNLVR--EIDSTHLTTKPSLKIIEGLEDNTVSTGESVTLRCDVLSTPTGVIYW- 77

  Fly   234 KKSGANKSTARI-GDGPILTLEKL----------------------ERQQAGVYQCTADNGVGDP 275
                 .|...|| ||..:...||:                      .....|.|:|.|.|| .|.
 Worm    78 -----EKDGQRIQGDKELNVFEKVLNAMGPTVESGIITSSYQIPCANLHHIGSYKCVATNG-HDT 136

  Fly   276 VTVDMRLDVLYPPDIQVEKSWIHSGEGFEAKLVCIVFADPVATVSWYQNSFPIQSTDRRIMATRA 340
            |....::.|                ||...|......:.||.|:| .::.|.:|.....::. ||
 Worm   137 VESSAKISV----------------EGQTVKCKSTRRSAPVITMS-TESRFELQDNAATLIC-RA 183

  Fly   341 NRHM-------------------------LTIRHIQQEDFGNYSCVADNSLGRSR 370
            :|..                         |.||.||..|.|:|.|:|.|..|.||
 Worm   184 DRRANWNWMFEDKKIDFDSGRYELLPSGDLLIRKIQWSDMGSYFCIAHNKYGESR 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518
IG_like 109..195 CDD:214653 3/25 (12%)
Ig 118..191 CDD:143165 3/21 (14%)
IG_like 205..274 CDD:214653 21/91 (23%)
IGc2 213..273 CDD:197706 21/82 (26%)
IGc2 301..367 CDD:197706 23/90 (26%)
FN3 392..486 CDD:238020
zig-3NP_509336.1 I-set 45..145 CDD:254352 24/106 (23%)
Ig 61..142 CDD:143165 22/87 (25%)
IG_like 177..244 CDD:214653 16/62 (26%)
Ig <191..237 CDD:299845 12/45 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.