Sequence 1: | NP_524454.2 | Gene: | klg / 42707 | FlyBaseID: | FBgn0017590 | Length: | 545 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_509336.1 | Gene: | zig-3 / 192088 | WormBaseID: | WBGene00006980 | Length: | 251 | Species: | Caenorhabditis elegans |
Alignment Length: | 250 | Identity: | 56/250 - (22%) |
---|---|---|---|
Similarity: | 83/250 - (33%) | Gaps: | 75/250 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 169 PQDAGDYVCQISDKINRDQVHTVEILVPPSVRAIPTSGQLQARKGGPITLECKGSGNPVPSIYWT 233
Fly 234 KKSGANKSTARI-GDGPILTLEKL----------------------ERQQAGVYQCTADNGVGDP 275
Fly 276 VTVDMRLDVLYPPDIQVEKSWIHSGEGFEAKLVCIVFADPVATVSWYQNSFPIQSTDRRIMATRA 340
Fly 341 NRHM-------------------------LTIRHIQQEDFGNYSCVADNSLGRSR 370 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
klg | NP_524454.2 | DUF1370 | 63..>124 | CDD:284518 | |
IG_like | 109..195 | CDD:214653 | 3/25 (12%) | ||
Ig | 118..191 | CDD:143165 | 3/21 (14%) | ||
IG_like | 205..274 | CDD:214653 | 21/91 (23%) | ||
IGc2 | 213..273 | CDD:197706 | 21/82 (26%) | ||
IGc2 | 301..367 | CDD:197706 | 23/90 (26%) | ||
FN3 | 392..486 | CDD:238020 | |||
zig-3 | NP_509336.1 | I-set | 45..145 | CDD:254352 | 24/106 (23%) |
Ig | 61..142 | CDD:143165 | 22/87 (25%) | ||
IG_like | 177..244 | CDD:214653 | 16/62 (26%) | ||
Ig | <191..237 | CDD:299845 | 12/45 (27%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |