DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klg and zig-2

DIOPT Version :9

Sequence 1:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_510069.1 Gene:zig-2 / 192087 WormBaseID:WBGene00006979 Length:238 Species:Caenorhabditis elegans


Alignment Length:234 Identity:49/234 - (20%)
Similarity:70/234 - (29%) Gaps:99/234 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 PSVRAIPTSGQLQARKGGPITLECKGSGNPVPSIYW----TKKSGANKSTAR---IGDG------ 248
            |.::...|........|....|.|..:|.|:|||||    .:..|...|...   :.||      
 Worm    31 PLLKFTRTPNDSNVTFGEKFVLSCGANGAPLPSIYWELNGMRIQGEETSNVYENILNDGKQVSNA 95

  Fly   249 ---------PILTLEKLERQQAGVYQCTADNGV-----------------------GDP---VTV 278
                     |..|     .:.:|.|:|..|||:                       |.|   :||
 Worm    96 AMVSSHYRIPCAT-----ARNSGAYKCIIDNGLTKLEHVAKVFVGGNKTNCALNDNGAPFISMTV 155

  Fly   279 DMRLDV-------LYPPDIQVEKSWIHSGEGFEAKLVCIVFADPVATVSWYQNSFPIQSTDRRIM 336
            |.||::       ....:...|.|| |.||                                :::
 Worm   156 DFRLEISNNAVALSCRSETATEWSW-HKGE--------------------------------QLL 187

  Fly   337 ATRANRHM------LTIRHIQQEDFGNYSCVADNSLGRS 369
            .....|:.      |.||:|...|.|.|:|.|.|..|.:
 Worm   188 TNDGERYQMFPSGDLIIRNISWSDMGEYNCTARNHFGET 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518
IG_like 109..195 CDD:214653
Ig 118..191 CDD:143165
IG_like 205..274 CDD:214653 22/113 (19%)
IGc2 213..273 CDD:197706 22/104 (21%)
IGc2 301..367 CDD:197706 12/71 (17%)
FN3 392..486 CDD:238020
zig-2NP_510069.1 I-set 34..134 CDD:254352 23/104 (22%)
Ig 34..121 CDD:299845 20/91 (22%)
Ig <179..232 CDD:299845 17/81 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.