DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klg and unc-89

DIOPT Version :10

Sequence 1:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001020985.1 Gene:unc-89 / 171990 WormBaseID:WBGene00006820 Length:8081 Species:Caenorhabditis elegans


Alignment Length:535 Identity:117/535 - (21%)
Similarity:207/535 - (38%) Gaps:98/535 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IISRSIRTGALAPPITAHASANANASGLRKSSQRRNRAPLQMNCPILIVISLG-------WL--- 57
            |.:.||.|......||....|.....||:|:|.:...       .|.:.:.:|       |.   
 Worm  3168 IATNSIGTATSTSKITTKVEAPVFEQGLKKTSVKEKE-------EIKMEVKVGGSAPDVEWFKDD 3225

  Fly    58 ----------LHAHAGSGGFAV---EAAISNRGSNSRSMSN----VQQSAVAASTLTATLPRFLS 105
                      :..:..:|.|.:   :||.::.|..:...||    .:.||.|..|.:...|.|:.
 Worm  3226 KPVSEDGNHEMKKNPETGVFTLVVKQAATTDAGKYTAKASNPAGTAESSAEAEVTQSLEKPTFVR 3290

  Fly   106 RGHTYRAVVGDTLVLPCQVENLGNFVLLW-RRGTNVLTASNIMVTRDERVRLIDG---YNLEISD 166
            ...|....:.:|..|...|:.:.:..:.| :.|..|.|.|:.::.:      ::|   |::.|.|
 Worm  3291 ELVTTEVKINETATLSVTVKGVPDPSVEWLKDGQPVQTDSSHVIAK------VEGSGSYSITIKD 3349

  Fly   167 LEPQDAGDYVCQISDKINRDQVH----TVEILVPPSVRAIPTSGQLQARKGGPITLECKGSGNPV 227
            ...:|:|.|.|:.::.....:..    .|:.||||..  :.....|:.::....||..|..|.|.
 Worm  3350 ARLEDSGKYACRATNPAGEAKTEANFAVVKNLVPPEF--VEKLSPLEVKEKESTTLSVKVVGTPE 3412

  Fly   228 PSIYWTKKSG---------ANKSTARIGDGPILTLEKLERQQAGVYQCTADNGVGDPVTVDMRLD 283
            ||:.|.|...         ..|.|| :|... ||:....:...|:|.|.|.|..|:.:|. ....
 Worm  3413 PSVEWFKDDTPISIDNVHVIQKQTA-VGSFS-LTINDARQGDVGIYSCRARNEAGEALTT-ANFG 3474

  Fly   284 VL---YPPDIQVEKSWIHSGEGFEAKLVCIVFADPVATVSWYQNSFPIQSTDRRIMA--TRANRH 343
            ::   .||:...:...:...|.....|...|...||..|.|:::..||...:..|.|  ..:..|
 Worm  3475 IIRDSIPPEFTQKLRPLEVREQETLDLKVTVIGTPVPNVEWFKDDKPINIDNSHIFAKDEGSGHH 3539

  Fly   344 MLTIRHIQQEDFGNYSCVADNSLGRSRKYMELSGRPGAAEFYSPKW--GRSPDSYNLTWKIDSYP 406
            .|||:..:.||.|.|:|.|.|..|.::....::.:   .|..:|.:  |..|      ::::...
 Worm  3540 TLTIKQARGEDVGVYTCKATNEAGEAKTTANMAVQ---EEIEAPLFVQGLKP------YEVEQGK 3595

  Fly   407 PLEEVRLLYRRVQMNETYQQPGRWHDFILTPEHRPASEPLTHIM-------SYT--IKNLHPGGY 462
            |.|.|      |::....:...:|.     .:..|.:....|::       |:|  ||:.:...:
 Worm  3596 PAELV------VRVEGKPEPEVKWF-----KDGVPIAIDNQHVIEKKGENGSHTLVIKDTNNADF 3649

  Fly   463 YEAIVQAKNRYGWNE 477
            .:...||.|:.|.:|
 Worm  3650 GKYTCQATNKAGKDE 3664

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 IG_like 109..195 CDD:214653 18/93 (19%)
Ig strand B 118..122 CDD:409353 1/3 (33%)
Ig strand C 131..135 CDD:409353 1/4 (25%)
Ig strand E 160..164 CDD:409353 1/3 (33%)
Ig strand F 174..179 CDD:409353 2/4 (50%)
Ig strand G 188..191 CDD:409353 0/6 (0%)
Ig_3 196..270 CDD:464046 22/82 (27%)
Ig_3 287..364 CDD:464046 23/78 (29%)
FN3 392..486 CDD:238020 17/95 (18%)
unc-89NP_001020985.1 SH3 65..124 CDD:473055
RhoGEF 153..328 CDD:238091
PH_unc89 341..455 CDD:270134
Ig strand B 565..569 CDD:409405
I-set <570..638 CDD:400151
Ig strand C 578..582 CDD:409405
Ig strand E 604..608 CDD:409405
Ig strand F 618..623 CDD:409405
Ig strand G 631..634 CDD:409405
I-set 648..737 CDD:400151
Ig strand B 665..669 CDD:409353
Ig strand C 678..682 CDD:409353
Ig strand E 703..707 CDD:409353
Ig strand F 717..722 CDD:409353
Ig strand G 730..733 CDD:409353
I-set 748..837 CDD:400151
Ig strand B 765..769 CDD:409353
Ig strand C 778..782 CDD:409353
Ig strand E 803..807 CDD:409353
Ig strand F 817..822 CDD:409353
Ig strand G 830..833 CDD:409353
Ig 844..935 CDD:472250
Ig strand B 861..865 CDD:409405
Ig strand C 874..878 CDD:409405
Ig strand E 900..904 CDD:409405
Ig strand F 915..920 CDD:409405
Ig strand G 928..931 CDD:409405
Ig 946..1034 CDD:472250
Ig strand B 963..967 CDD:409543
Ig strand C 976..980 CDD:409543
Ig strand E 1002..1006 CDD:409543
Ig strand F 1010..1019 CDD:409543
Ig strand G 1027..1030 CDD:409543
I-set 1044..1133 CDD:400151
Ig strand B 1061..1065 CDD:409353
Ig strand C 1074..1078 CDD:409353
Ig strand E 1099..1103 CDD:409353
Ig strand F 1113..1118 CDD:409353
Ig strand G 1126..1129 CDD:409353
Ig 1140..1237 CDD:472250
Ig strand B 1157..1161 CDD:409543
Ig strand C 1170..1174 CDD:409543
Ig strand E 1200..1204 CDD:409543
Ig strand F 1208..1222 CDD:409543
Ig strand G 1230..1233 CDD:409543
PTZ00121 <1304..1992 CDD:173412
Ig 1982..2068 CDD:472250
Ig strand B 1999..2003 CDD:409353
Ig strand C 2010..2014 CDD:409353
Ig strand E 2036..2040 CDD:409353
Ig strand F 2048..2053 CDD:409353
Ig strand G 2061..2064 CDD:409353
I-set 2081..2164 CDD:400151
Ig strand B 2092..2096 CDD:409406
Ig strand C 2105..2109 CDD:409406
Ig strand E 2130..2134 CDD:409406
Ig strand F 2144..2149 CDD:409406
Ig strand G 2157..2160 CDD:409406
Ig 2171..2262 CDD:472250
Ig strand B 2188..2192 CDD:409353
Ig strand C 2202..2206 CDD:409353
Ig strand E 2226..2232 CDD:409353
Ig strand F 2242..2247 CDD:409353
Ig strand G 2255..2258 CDD:409353
I-set 2269..2360 CDD:400151
Ig strand B 2286..2290 CDD:409405
Ig strand C 2299..2303 CDD:409405
Ig strand E 2326..2330 CDD:409405
Ig strand F 2340..2345 CDD:409405
Ig strand G 2353..2356 CDD:409405
I-set 2367..2456 CDD:400151
Ig strand B 2384..2388 CDD:409543
Ig strand C 2397..2401 CDD:409543
Ig strand E 2422..2426 CDD:409543
Ig strand F 2436..2441 CDD:409543
Ig strand G 2449..2452 CDD:409543
Ig 2463..2554 CDD:472250
Ig strand B 2480..2484 CDD:409405
Ig strand C 2494..2498 CDD:409405
Ig strand E 2520..2524 CDD:409405
Ig strand F 2534..2539 CDD:409405
Ig strand G 2547..2550 CDD:409405
Ig 2563..2652 CDD:472250
Ig strand C 2593..2597 CDD:409405
Ig strand E 2618..2622 CDD:409405
Ig strand F 2632..2637 CDD:409405
Ig strand G 2645..2648 CDD:409405
I-set 2659..2747 CDD:400151
Ig strand B 2675..2679 CDD:409543
Ig strand C 2688..2692 CDD:409543
Ig strand E 2713..2717 CDD:409543
Ig strand F 2727..2732 CDD:409543
Ig strand G 2740..2743 CDD:409543
Ig 2754..2843 CDD:472250
Ig strand C 2784..2788 CDD:409353
Ig strand E 2809..2813 CDD:409353
Ig strand F 2824..2829 CDD:409353
Ig strand G 2837..2840 CDD:409353
I-set 2887..2981 CDD:400151
Ig strand B 2904..2908 CDD:409405
Ig strand C 2917..2921 CDD:409405
Ig strand E 2947..2951 CDD:409405
Ig strand F 2961..2966 CDD:409405
Ig strand G 2974..2977 CDD:409405
I-set 2994..3082 CDD:400151
Ig strand B 3011..3015 CDD:409353
Ig strand C 3024..3028 CDD:409353
Ig strand E 3046..3052 CDD:409353
Ig strand F 3062..3067 CDD:409353
Ig strand G 3075..3078 CDD:409353
Ig 3087..3183 CDD:472250 4/14 (29%)
Ig strand B 3104..3108 CDD:409543
Ig strand C 3117..3121 CDD:409543
Ig strand E 3149..3154 CDD:409543