DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klg and CNTN4

DIOPT Version :10

Sequence 1:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_783200.1 Gene:CNTN4 / 152330 HGNCID:2174 Length:1026 Species:Homo sapiens


Alignment Length:462 Identity:108/462 - (23%)
Similarity:175/462 - (37%) Gaps:147/462 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 LPCQVENLGNFVLLWR-RGTNVLTASNIMVTRDERVRLIDGYNLEISDLEPQDAGDYVCQISDK- 182
            |.|:|:......:.|: .||:|.|.      .|.|..:::|..|..:..:.||||.|.|..::. 
Human    48 LNCEVKGNPKPHIRWKLNGTDVDTG------MDFRYSVVEGSLLINNPNKTQDAGTYQCTATNSF 106

  Fly   183 ---INRDQVHTVEILVPPSVRAIPTSGQLQARKGGPITLEC---KGSG--------NPVPSIYWT 233
               ::|:.......|.....|   |...:..|:|..:.|.|   ..||        |..|| |..
Human   107 GTIVSREAKLQFAY
LDNFKTR---TRSTVSVRRGQGMVLLCGPPPHSGELSYAWIFNEYPS-YQD 167

  Fly   234 KKSGANKSTARIGDGPILTLEKLERQQAGVYQCTADNGV------GDPVTVDMRLDVL---YPPD 289
            .:...::.|..      |.:.|:|:...|.|.|...|.|      |.|..:.:|.|.:   |.|.
Human   168 NRRFVSQETGN------LYIAKVEKSDVGNYTCVVTNTVTNHKVLGPPTPLI
LRNDGVMGEYEPK 226

  Fly   290 IQVE-KSWIHSGEGFEAKLVCIVFADPVATVSWYQNSFPIQSTDRRIMATRANRH----MLTIRH 349
            |:|: ...:.:.:|...||.|....:||.|:.|       :..|.:.:|.:|.||    :|.|.:
Human   227 IEVQFPETVPTAKGATVKLECFALGNPVPTIIW-------RRADGKPIARKARRHKSNGILEIPN 284

  Fly   350 IQQEDFGNYSCVADNSLGRSRKYMELSGRPGAAEFYS-PKW----------------------GR 391
            .||||.|.|.|||:||.|::....:|:       ||: |.|                      ||
Human   285 FQQEDAGLYECVAENSRGKNVARGQLT-------FYAQPNWIQKINDIHVAMEENVFWECKANGR 342

  Fly   392 SPDSYNLTWKIDSYPPLEEVRLLYR-RVQMNETYQQPGRWHDFILTPEHRPASEPLTHIMSYTIK 455
            ...:|.  |..:..|      ||.| |:|:.:                         ..::.||.
Human   343 PKPTYK--WLKNGEP------LLTRDRIQIEQ-------------------------GTLNITIV 374

  Fly   456 NLHPGGYYEAIVQAKNRYGWNEVSDIFQFVVATNSQ----DIGPE--------------DAEVVA 502
            ||...|.|:.:  |:|::|          |:.:|::    .:||:              ..|||.
Human   375 NLSDAGMYQCL--AENKHG----------VIFSNAELSVIAVGPDFSRTLLKRVTLVKVGGEVVI 427

  Fly   503 SSKSRSN 509
            ..|.:::
Human   428 ECKPKAS 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 IG_like 109..195 CDD:214653 19/79 (24%)
Ig strand B 118..122 CDD:409353 1/1 (100%)
Ig strand C 131..135 CDD:409353 0/3 (0%)
Ig strand E 160..164 CDD:409353 1/3 (33%)
Ig strand F 174..179 CDD:409353 2/4 (50%)
Ig strand G 188..191 CDD:409353 0/2 (0%)
Ig_3 196..270 CDD:464046 19/84 (23%)
Ig_3 287..364 CDD:464046 27/81 (33%)
FN3 392..486 CDD:238020 17/94 (18%)
CNTN4NP_783200.1 Ig 25..120 CDD:472250 19/77 (25%)
Ig strand B 46..50 CDD:409435 1/1 (100%)
Ig strand C 59..63 CDD:409435 0/3 (0%)
Ig strand E 82..86 CDD:409435 1/3 (33%)
Ig strand F 97..102 CDD:409435 2/4 (50%)
Ig strand G 111..114 CDD:409435 1/2 (50%)
Ig 129..213 CDD:472250 21/90 (23%)
Ig strand B 140..144 CDD:409353 1/3 (33%)
Ig strand C 154..158 CDD:409353 0/3 (0%)
Ig strand E 177..181 CDD:409353 1/9 (11%)
Ig strand F 191..196 CDD:409353 2/4 (50%)
Ig strand G 207..210 CDD:409353 1/2 (50%)
Ig 225..313 CDD:472250 31/101 (31%)
Ig strand B 243..247 CDD:409353 2/3 (67%)
Ig strand C 256..260 CDD:409353 2/10 (20%)
Ig strand E 278..282 CDD:409353 1/3 (33%)
Ig strand F 292..297 CDD:409353 2/4 (50%)
Ig strand G 305..308 CDD:409353 0/2 (0%)
Ig 318..401 CDD:472250 22/127 (17%)
Ig strand B 333..337 CDD:143205 0/3 (0%)
Ig strand C 346..350 CDD:143205 1/5 (20%)
Ig strand E 367..371 CDD:143205 0/3 (0%)
Ig strand F 381..386 CDD:143205 1/6 (17%)
Ig strand G 394..397 CDD:143205 0/2 (0%)
Ig 406..494 CDD:472250 5/29 (17%)
Ig strand B 425..429 CDD:409353 2/3 (67%)
Ig strand C 438..442 CDD:409353
Ig strand E 460..464 CDD:409353
Ig strand F 474..479 CDD:409353
Ig strand G 487..490 CDD:409353
Ig6_Contactin-4 496..597 CDD:409439
Ig strand A 496..502 CDD:409439
Ig strand A' 505..510 CDD:409439
Ig strand B 513..521 CDD:409439
Ig strand C 530..534 CDD:409439
Ig strand D 555..558 CDD:409439
Ig strand E 559..563 CDD:409439
Ig strand F 572..579 CDD:409439
Ig strand G 586..590 CDD:409439
FN3 597..690 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 685..710
FN3 703..795 CDD:238020
FN3 <764..>1014 CDD:442628
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 886..907
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.