DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klg and IGSF5

DIOPT Version :9

Sequence 1:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:XP_011527774.1 Gene:IGSF5 / 150084 HGNCID:5952 Length:497 Species:Homo sapiens


Alignment Length:257 Identity:50/257 - (19%)
Similarity:95/257 - (36%) Gaps:52/257 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PPITAHAS--ANANASGLRKSSQRRNRA-----PL--QMNCPILIV----------ISLGWLLHA 60
            |.:.:|..  |..:.:||......:|..     |:  ..:||:.:.          .|:...|||
Human    19 PSLWSHLEMVAGHDLAGLVTEQSEKNEGGSCCRPMWCSASCPLSLTSNFSRDGVCFCSVVKSLHA 83

  Fly    61 HAG-----SGGFAVEAAISNRGSNSRSMSNVQQSAVAASTLTATLPRFLSRGHTYRAVVGDTLVL 120
            |.|     :..|......|:..:|..|...::...:..:..:.:....:......|.:.|.....
Human    84 HRGLLQARAARFYFLHQDSSHATNGESSQLLELIFLEKNAGSGSGNEVIEGPQNARVLKGSQARF 148

  Fly   121 PCQVENLGNFVLLWRRGTNVLTASNIM---VTRDE--RVRLIDGYN----LEISDLEPQDAGDYV 176
            .|.|.. |..:::|.....|:.:...|   :|.|.  ..|...|.|    :.|.::||.|:|:..
Human   149 NCTVSQ-GWKLIMWALSDMVVLSVRPMEPIITNDRFTSQRYDQGGNFTSEMIIHNVEPSDSGNIR 212

  Fly   177 CQI-SDKINRDQVHTVEI---LVPPSVRAIPTSGQLQARKGGPITLECKGSGNPVPSIYWTK 234
            |.: :.:::.....||::   |..|||..:....:       |..:.|      :|| :||:
Human   213 CSLQNSRLHGSAYLTVQVMGELFIPSVNLVVAENE-------PCEVTC------LPS-HWTR 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518 8/65 (12%)
IG_like 109..195 CDD:214653 21/98 (21%)
Ig 118..191 CDD:143165 17/82 (21%)
IG_like 205..274 CDD:214653 6/30 (20%)
IGc2 213..273 CDD:197706 6/22 (27%)
IGc2 301..367 CDD:197706
FN3 392..486 CDD:238020
IGSF5XP_011527774.1 IG_like 135..228 CDD:214653 19/93 (20%)
Ig <200..230 CDD:299845 8/29 (28%)
Ig 236..307 CDD:299845 9/39 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143424
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.