DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klg and Cntn4

DIOPT Version :10

Sequence 1:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_446331.1 Gene:Cntn4 / 116658 RGDID:621361 Length:1026 Species:Rattus norvegicus


Alignment Length:388 Identity:97/388 - (25%)
Similarity:162/388 - (41%) Gaps:77/388 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 LPCQVENLGNFVLLWRRGTNVLTASNIMVTRDERVRLIDGYNLEISDLEPQDAGDYVCQISDK-- 182
            |.|:|:......:.|:     |..:::.:..|.|..:::|..|..:..:.||:|.|.|..::.  
  Rat    48 LSCEVKGNPKPHIRWK-----LNGTDVDIGMDFRYSVVEGSLLINNPNKTQDSGTYQCIATNSFG 107

  Fly   183 --INRDQVHTVEILVPPSVRAIPTSGQLQARKGGPITLEC---KGSG--------NPVPSIYWTK 234
              ::|:.......|.....|   |...:..|:|..:.|.|   ..||        |..|| |...
  Rat   108 TIVSREAKLQFAY
LENFKTR---TRSTVSVRRGQGMVLLCGPPPHSGELSYAWIFNEHPS-YQDN 168

  Fly   235 KSGANKSTARIGDGPILTLEKLERQQAGVYQCTADNGV------GDPVTVDMRLDVL---YPPDI 290
            :...::.|..      |.:.|:|:...|.|.|...|.|      |.|..:.:|.|.:   |.|.|
  Rat   169 RRFVSQETGN------LYIAKVEKADVGNYTCVVTNTVTSHQVLGPPTPLI
LRNDGVMGEYEPKI 227

  Fly   291 QVE-KSWIHSGEGFEAKLVCIVFADPVATVSWYQNSFPIQSTDRRIMATRANRH----MLTIRHI 350
            :|: ...:.:.:|...||.|....:||.|:.|       :..|.:.:|.:|.||    :|.|.:.
  Rat   228 EVQFPETVPAEKGSTVKLECFALGNPVPTILW-------RRADGKPIARKARRHKSSGILEIPNF 285

  Fly   351 QQEDFGNYSCVADNSLGRSRKYMELSGRPGAAEFYS-PKWGRSPDSYNLTWKIDSYPPLEEVRLL 414
            ||||.|:|.|||:||.|::.       ..|...||: |.|.:..:        |.:..:||  .:
  Rat   286 QQEDAGSYECVAENSRGKNI-------AKGQVTFY
AQPNWVQIIN--------DIHVAMEE--SV 333

  Fly   415 YRRVQMNETYQQPGRW---HDFILTPEHRPASEPLTHIMSYTIKNLHPGGYYEAIVQAKNRYG 474
            :...:.|...:...||   .|.:||.|.....:...:|   ||.||...|.|:.:  |:|::|
  Rat   334 FWECKANGRPKPTYRWLKNGDPLLTRERIQIEQGTLNI---TIVNLSDAGMYQCV--AENKHG 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 IG_like 109..195 CDD:214653 15/78 (19%)
Ig strand B 118..122 CDD:409353 1/1 (100%)
Ig strand C 131..135 CDD:409353 0/3 (0%)
Ig strand E 160..164 CDD:409353 1/3 (33%)
Ig strand F 174..179 CDD:409353 2/4 (50%)
Ig strand G 188..191 CDD:409353 0/2 (0%)
Ig_3 196..270 CDD:464046 19/84 (23%)
Ig_3 287..364 CDD:464046 27/81 (33%)
FN3 392..486 CDD:238020 20/86 (23%)
Cntn4NP_446331.1 Ig 25..120 CDD:472250 15/76 (20%)
Ig strand B 46..50 CDD:409353 1/1 (100%)
Ig strand C 59..63 CDD:409353 0/3 (0%)
Ig strand E 82..86 CDD:409353 1/3 (33%)
Ig strand F 97..102 CDD:409353 2/4 (50%)
Ig strand G 111..114 CDD:409353 1/2 (50%)
Ig 129..213 CDD:472250 21/90 (23%)
Ig strand B 140..144 CDD:409353 1/3 (33%)
Ig strand C 154..158 CDD:409353 0/3 (0%)
Ig strand E 177..181 CDD:409353 1/9 (11%)
Ig strand F 191..196 CDD:409353 2/4 (50%)
Ig strand G 207..210 CDD:409353 1/2 (50%)
Ig 225..313 CDD:472250 31/101 (31%)
Ig strand B 243..247 CDD:409353 2/3 (67%)
Ig strand C 256..260 CDD:409353 2/10 (20%)
Ig strand E 278..282 CDD:409353 1/3 (33%)
Ig strand F 292..297 CDD:409353 2/4 (50%)
Ig strand G 305..308 CDD:409353 0/9 (0%)
Ig 318..401 CDD:472250 21/89 (24%)
Ig strand B 333..337 CDD:143205 0/3 (0%)
Ig strand C 346..350 CDD:143205 1/3 (33%)
Ig strand E 367..371 CDD:143205 0/3 (0%)
Ig strand F 381..386 CDD:143205 1/6 (17%)
Ig strand G 394..397 CDD:143205
Ig 406..494 CDD:472250
Ig strand B 425..429 CDD:409353
Ig strand C 438..442 CDD:409353
Ig strand E 460..464 CDD:409353
Ig strand F 474..479 CDD:409353
Ig strand G 487..490 CDD:409353
Ig6_Contactin-4 496..597 CDD:409439
Ig strand A 496..502 CDD:409439
Ig strand A' 505..510 CDD:409439
Ig strand B 513..521 CDD:409439
Ig strand C 530..534 CDD:409439
Ig strand D 555..558 CDD:409439
Ig strand E 559..563 CDD:409439
Ig strand F 572..579 CDD:409439
Ig strand G 586..590 CDD:409439
FN3 597..690 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 685..710
FN3 703..792 CDD:238020
FN3 <769..>1014 CDD:442628
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.