DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klg and lsamp

DIOPT Version :9

Sequence 1:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:XP_031751462.1 Gene:lsamp / 100124984 XenbaseID:XB-GENE-5759171 Length:368 Species:Xenopus tropicalis


Alignment Length:352 Identity:97/352 - (27%)
Similarity:152/352 - (43%) Gaps:66/352 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KSSQRRNRAPLQMNCPILIVISLGWLLHAHAGSGGFAVEAAISNRGSNSRSMSNVQQSAVAASTL 96
            :|...||:.|       |:::.|..||..     |..|.:     |..:||..|:          
 Frog     4 RSQADRNQLP-------LLLLRLLCLLPT-----GLPVRS-----GDFNRSTDNI---------- 41

  Fly    97 TATLPRFLSRGHTYRAVVGDTLVLPCQVENLGNFVLLWRRGTNVLTASNIMVTRDERVRL----I 157
                        |.|.  |||.:|.|.||:..:.| .|...:.::.|.:...:.|.||.|    :
 Frog    42 ------------TVRQ--GDTAILRCFVEDRSSRV-AWLNRSGIIFAGDDKWSLDPRVELEKRSL 91

  Fly   158 DGYNLEISDLEPQDAGDYVCQISDK--INRDQVHTVEILVPPSVRAIPTSGQLQARKGGPITLEC 220
            ..|:|.|..::..|.|.|.|.:..|  ....||:.: :.|||.:..|  |..:...:|..:||.|
 Frog    92 LEYSLRIQKVDVSDEGPYTCSVQTKQHTKTTQVYLI-VQVPPKISNI--SADITVNEGSNVTLMC 153

  Fly   221 KGSGNPVPSIYW---TKKSGANKSTARIGDGPILTLEKLERQQAGVYQCTADNGVGDPVTVDMRL 282
            ...|.|.|.|.|   |..:|.:.:....|:...|.::.:.|:|:|.|:|.|.|.|.......:|:
 Frog   154 IAYGRPEPMITWRHLTPTAGTSPARDFEGEEEFLEIQGITREQSGRYECKAANEVASADVKQVRV 218

  Fly   283 DVLYPPDIQVEKSWIHSGEGFEAKLVCIVFADPVATVSWYQNSFPIQSTDRRIMATR-------A 340
            .|.|||.|...|| ..:..|.:|.|.|...|.|.....||::    .:..|||.:.:       .
 Frog   219 TVNYPPIITESKS-NEATTGKQAILRCEASAVPAPDFEWYKD----DTRSRRINSAQGLEIRNTG 278

  Fly   341 NRHMLTIRHIQQEDFGNYSCVADNSLG 367
            :|.:|.:.::.:|.:|||:|||.|.||
 Frog   279 SRSVLMVANVTEEHYGNYTCVAANKLG 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518 13/60 (22%)
IG_like 109..195 CDD:214653 26/91 (29%)
Ig 118..191 CDD:143165 21/78 (27%)
IG_like 205..274 CDD:214653 22/71 (31%)
IGc2 213..273 CDD:197706 20/62 (32%)
IGc2 301..367 CDD:197706 21/72 (29%)
FN3 392..486 CDD:238020
lsampXP_031751462.1 Ig 38..128 CDD:416386 27/115 (23%)
FR1 38..54 CDD:409353 7/39 (18%)
Ig strand A' 39..45 CDD:409353 2/27 (7%)
Ig strand B 47..55 CDD:409353 4/7 (57%)
CDR1 55..59 CDD:409353 2/3 (67%)
FR2 60..67 CDD:409353 2/7 (29%)
Ig strand C 60..66 CDD:409353 2/6 (33%)
CDR2 68..78 CDD:409353 1/9 (11%)
Ig strand C' 70..73 CDD:409353 0/2 (0%)
Ig strand C' 75..78 CDD:409353 0/2 (0%)
FR3 79..114 CDD:409353 11/34 (32%)
Ig strand D 83..90 CDD:409353 3/6 (50%)
Ig strand E 93..99 CDD:409353 2/5 (40%)
Ig strand F 106..114 CDD:409353 3/7 (43%)
CDR3 115..119 CDD:409353 1/3 (33%)
Ig strand G 119..128 CDD:409353 2/9 (22%)
FR4 121..128 CDD:409353 2/7 (29%)
Ig_3 131..206 CDD:404760 23/76 (30%)
Ig strand A' 138..143 CDD:409353 1/4 (25%)
Ig strand B 149..156 CDD:409353 3/6 (50%)
Ig strand C 162..167 CDD:409353 2/4 (50%)
Ig strand C' 173..175 CDD:409353 1/1 (100%)
Ig strand E 185..191 CDD:409353 1/5 (20%)
Ig strand F 198..205 CDD:409353 3/6 (50%)
Ig strand G 212..220 CDD:409353 1/7 (14%)
Ig_3 223..302 CDD:404760 25/83 (30%)
putative Ig strand A 224..230 CDD:409353 2/5 (40%)
Ig strand B 240..244 CDD:409353 2/3 (67%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 281..285 CDD:409353 1/3 (33%)
Ig strand F 295..300 CDD:409353 3/4 (75%)
Ig strand G 308..311 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.