DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4704 and Micu3

DIOPT Version :9

Sequence 1:NP_001287476.1 Gene:CG4704 / 42706 FlyBaseID:FBgn0039029 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_084386.1 Gene:Micu3 / 78506 MGIID:1925756 Length:523 Species:Mus musculus


Alignment Length:372 Identity:96/372 - (25%)
Similarity:163/372 - (43%) Gaps:91/372 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FRYFATIKMKNKSGKWELYMTPNDFLRSI---QPGL-KQPENLGLDKF-QILDEHAANKWIPEVK 76
            ||.||:|:.:.     :|:|||.||:.::   :|.. |..::|...:. |:|.|..     |..|
Mouse   142 FRLFASIECEG-----QLFMTPYDFILAVTTDEPKFAKTWKSLSKQELSQMLSETP-----PVWK 196

  Fly    77 DDS-IFLKIEKRGLLTYSDYVLLTILLSIPERNVRISFKLFDLNGDGDVTIDE-----LDTVFMA 135
            ..| :|..:::||:::|::|:.|..:|:.|....||:|.:||.  ||:..:|:     |..:|..
Mouse   197 GSSKLFRNLKERGVISYTEYLFLLCILTKPHAGFRIAFNMFDT--DGNEMVDKKEFLVLQEIFRK 259

  Fly   136 MTQ-------------------GEVSMMNSHLKS------------------------------- 150
            ..:                   |..|..||.||:                               
Mouse   260 KNEKRETKGDEEKRAMLRLQLYGYHSPTNSVLKTDAGELVSRSYWDTLRRSTSQALFSDLAERAD 324

  Fly   151 -------------HFFGHRLNKTLSIDEFLKFLHALHIEIHTDQFQNLLKESSSVISELDFAKVV 202
                         ||||.:....|:.::|.:|:..|..|:...:|.: .....:.|||.|||.::
Mouse   325 DITSLVADTTLLVHFFGKKGKAELNFEDFYRFMDNLQTEVLEIEFLS-YSNGMNTISEEDFAHIL 388

  Fly   203 LGLRKSRSERREI-LKRVKKKFGQMDHGITLEEFLAFFRFVQDVSIMDNALAFYYFTGADISPKT 266
              ||.:..|...: |:.|:....: :.|||.:||.:||:|:.::.....||..|.|....|....
Mouse   389 --LRYTNVENTSVFLENVRYSISE-EKGITFDEFRSFFQFLNNLEDFAIALNMYNFASRSIGQDE 450

  Fly   267 MRHIAYVVTGVKLSQHLTDVIFCIFDRNNDNIIQRKEFTDMRRQWMH 313
            .:...||.||:|||.||.:.:|.|||.:.|:.:..|||..:.:..:|
Mouse   451 FKRAVYVATGLKLSPHLVNTVFKIFDVDKDDQLSYKEFIGIMKDRLH 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4704NP_001287476.1 EFh 113..171 CDD:298682 21/125 (17%)
EF-hand_8 259..307 CDD:290545 18/47 (38%)
Micu3NP_084386.1 DUF835 <349..437 CDD:283432 25/91 (27%)
EF-hand_8 442..495 CDD:290545 18/52 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2643
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.