DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4704 and Micu2

DIOPT Version :9

Sequence 1:NP_001287476.1 Gene:CG4704 / 42706 FlyBaseID:FBgn0039029 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_082919.1 Gene:Micu2 / 68514 MGIID:1915764 Length:432 Species:Mus musculus


Alignment Length:311 Identity:84/311 - (27%)
Similarity:142/311 - (45%) Gaps:45/311 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ELYMTPNDFLRSIQPGLKQPENLGLDKFQILDEHAANKWIPEVKD--------DSIFLKIEKRGL 89
            |.||||.|||.|:.  .:|.|.      :.|.:..|.|.|.:|..        .:.|..:..:|:
Mouse    98 EYYMTPRDFLFSVM--FEQVER------KTLVKKLAKKDIEDVLSGIQTARCGSTFFRDLGDKGV 154

  Fly    90 LTYSDYVLLTILLSIPERNVRISFKLFDLNG-------------------DGDVTIDELDTVFMA 135
            ::|::|:.|..:|:.|.....::||:.|::|                   ||..|:...:|.:..
Mouse   155 ISYTEYLFLLTILTKPHSGFHVAFKMLDVDGNEMIERKEFVKLQKIISKQDGFKTVKTNETEYQD 219

  Fly   136 MTQGEVSMMNSHLKSHFFGHRLNKTLSIDEFLKFLHALHIEIHTDQFQNLLKESSSVISELDFAK 200
            .|..|.. :|:.|:..|||.|..|.|...||.:|:..|..|:...:|....|..:.:..| |||:
Mouse   220 PTVKEPG-VNTTLQVRFFGKRGEKKLHYKEFRRFMENLQTEVQEMEFLQFSKGLNFMRKE-DFAE 282

  Fly   201 VVLGLRKSRSERREIL-KRVKKKFGQMDHGITLEEFLAFFRFVQDVSIMDNALAFYYFTGA--DI 262
            .:|..  :.:|.::|. :.|::|. .:...|:|:||.:|..|.  ..:.|.|:|...|:.|  .:
Mouse   283 WLLFF--TNTENKDIYWRNVREKL-SVGESISLDEFKSFCHFT--THLEDFAIAMQMFSLAHRPV 342

  Fly   263 SPKTMRHIAYVVTGVKLSQHLTDVIFCIFDRNNDNIIQRKEFTDMRRQWMH 313
            .....:....|.||.:||.:|.|.:|.|||.:.|..:...||..:.:..||
Mouse   343 RLAEFKRAVKVATGQELSDNLLDTVFKIFDLDGDECLSHGEFLGVLKNRMH 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4704NP_001287476.1 EFh 113..171 CDD:298682 21/76 (28%)
EF-hand_8 259..307 CDD:290545 15/49 (31%)
Micu2NP_082919.1 EF-hand_8 345..391 CDD:290545 14/45 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2643
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D425365at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.