DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4704 and micu3a

DIOPT Version :9

Sequence 1:NP_001287476.1 Gene:CG4704 / 42706 FlyBaseID:FBgn0039029 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_021326830.1 Gene:micu3a / 559552 ZFINID:ZDB-GENE-070713-1 Length:544 Species:Danio rerio


Alignment Length:386 Identity:98/386 - (25%)
Similarity:165/386 - (42%) Gaps:101/386 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 HAHPTKIFRYFATIKMKNKSGKWELYMTPNDFLRSI---QPGLKQPENLGLDKFQILDEHAANKW 71
            |.|.   ||.|::::.:.     :|||||.:|:.|:   :|.:|:|.. .|.|.::  |...:..
Zfish   151 HEHR---FRLFSSVEYEG-----QLYMTPQNFIESVTMSEPRIKKPWR-SLTKQEL--EKILSDT 204

  Fly    72 IPEVKDDS-IFLKIEKRGLLTYSDYVLLTILLSIPERNVRISFKLFDLNGDGDVTIDE-----LD 130
            .|..|..| :|..:.:||::.|::|:.|..:|:.|....:|:|.:||  .||:..:|:     |.
Zfish   205 PPVWKGTSKLFRNLRERGIIAYTEYLFLLCILTKPHAGFKIAFNMFD--ADGNQMVDKREFMVLQ 267

  Fly   131 TVF--------------------MAMTQGEVSMMNSHLKS------------------------- 150
            .:|                    |.:...:|:.:||.||.                         
Zfish   268 EIFRKKNEKKGRKGDAEKSAQLSMQLYGYQVAPVNSVLKKESQEFVPRSYWDKLRRGASQALFSD 332

  Fly   151 ----------------------HFFGHRLNKTLSIDEFLKFLHALHIEIHTDQFQNLLKESSSVI 193
                                  ||||.:....|:.|:|.:|:..|..|:...:|....| ..:.|
Zfish   333 LAEDFKLERADENMMIDTTLLVHFFGKKGKAELTFDDFYRFMDNLQTEMLEIEFLTYSK-GMTTI 396

  Fly   194 SELDFAKVVL------GLRKSRSERREILKRVKKKFGQMDHGITLEEFLAFFRFVQDVSIMDNAL 252
            ||.|||:::|      .:|......|:.:...||     ..|||.|||.:||:|:.::.....|:
Zfish   397 SEEDFARILLRYTNVEDIRSYLENVRQCIPDEKK-----PEGITFEEFRSFFQFLNNLEDFAIAM 456

  Fly   253 AFYYFTGADISPKTMRHIAYVVTGVKLSQHLTDVIFCIFDRNNDNIIQRKEFTDMRRQWMH 313
            ..|.|....|.........||.||:||::||.:.||.|||.::|:.:..|||..:.:..:|
Zfish   457 QMYNFACRSIGQDEFARAVYVATGLKLTRHLVNTIFKIFDVDHDDQLSYKEFIGIMKDRLH 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4704NP_001287476.1 EFh 113..171 CDD:298682 22/129 (17%)
EF-hand_8 259..307 CDD:290545 18/47 (38%)
micu3aXP_021326830.1 HAD_like 138..>223 CDD:328728 23/82 (28%)
EFh_MICU3 242..516 CDD:320083 68/281 (24%)
EF-hand motif 242..271 CDD:320083 8/30 (27%)
EF-hand motif 351..381 CDD:320083 9/29 (31%)
EF-hand motif 450..479 CDD:320083 6/28 (21%)
EF-hand motif 487..516 CDD:320083 10/28 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2643
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D425365at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.