DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4704 and MICU3

DIOPT Version :9

Sequence 1:NP_001287476.1 Gene:CG4704 / 42706 FlyBaseID:FBgn0039029 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001262741.1 Gene:MICU3 / 42357 FlyBaseID:FBgn0038735 Length:524 Species:Drosophila melanogaster


Alignment Length:404 Identity:99/404 - (24%)
Similarity:168/404 - (41%) Gaps:111/404 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QYENRLRLHAHPTKIFRYFATIKMKNKSGKWELYMTPNDFLRSI-----QPGLKQPENLGLDKFQ 61
            :.|| ::|.|...:..: ||:::..:     :|||||.|||.|:     :|.||: ..|..|:  
  Fly    91 ELEN-VKLTARERRFIK-FASVEYDD-----QLYMTPQDFLDSVVEQEPRPRLKR-RQLSSDE-- 145

  Fly    62 ILDEHAANKWIPEVKDDS--IFLKIEKRGLLTYSDYVLLTILLSIPERNVRISFKLFDLNGDGDV 124
             :|::..|  .|.:|..|  :|..:..:|:::|::|:.|..:|:.|:...||:|.:||.:|:..|
  Fly   146 -VDKYKEN--TPALKKGSTRLFRNLRDKGIVSYTEYLFLLSILTKPKSGFRIAFNMFDTDGNQRV 207

  Fly   125 TIDELDTVF------------------------------------MAMTQGEVSMMN-------- 145
            ..||...:.                                    ||:.|.:..:|.        
  Fly   208 DKDEFLVIISILAGALKDTQNVDPQTKRILSRLVSYDEQSQMTKPMAVPQAKRGIMERIFSGAWK 272

  Fly   146 ------------------------------------SHLKSHFFGHRLNKTLSIDEFLKFLHALH 174
                                                :.|:.||||.|....::.|.|.:|:..|.
  Fly   273 EKHGEQEPEEELATPTPLEQNYVNDGEGLQRRHMVATTLQLHFFGKRGTGVINYDNFYRFMDNLQ 337

  Fly   175 IEIHTDQFQNLLKESSSVISELDFAKVVLGLRKSRSERREI-----LKRVKKKFGQMDHGITLEE 234
            .|:...:|....| .:||||||||||::|......::..::     |:|||.     :.||:..:
  Fly   338 TEVLELEFHEFSK-GNSVISELDFAKILLRYTYLATDEYDVFLERLLERVKD-----EKGISFHD 396

  Fly   235 FLAFFRFVQDVSIMDNALAFYYFTGADISPKTMRHIAYVVTGVKLSQHLTDVIFCIFDRNNDNII 299
            |..|..|:.::.....|:..|......||.........:.||.|||.||.|.:|.|||.:.|.::
  Fly   397 FRDFCHFLNNLDDFTIAMRMYTLADRAISKDEFSRAVKICTGYKLSPHLIDTVFAIFDADGDGLL 461

  Fly   300 QRKEFTDMRRQWMH 313
            ..|||..:.:..:|
  Fly   462 SYKEFIAIMKDRLH 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4704NP_001287476.1 EFh 113..171 CDD:298682 20/137 (15%)
EF-hand_8 259..307 CDD:290545 18/47 (38%)
MICU3NP_001262741.1 EF-hand_7 421..470 CDD:290234 18/48 (38%)
EF-hand_8 424..473 CDD:290545 18/48 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456387
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2643
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D38732at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12294
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.