DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4704 and Micu3

DIOPT Version :9

Sequence 1:NP_001287476.1 Gene:CG4704 / 42706 FlyBaseID:FBgn0039029 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_006253262.1 Gene:Micu3 / 364601 RGDID:1563411 Length:523 Species:Rattus norvegicus


Alignment Length:372 Identity:96/372 - (25%)
Similarity:162/372 - (43%) Gaps:91/372 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FRYFATIKMKNKSGKWELYMTPNDFLRSI---QPGL-KQPENLGLDKF-QILDEHAANKWIPEVK 76
            ||.||:|:.:.     :|:|||.||:.::   :|.. |..::|...:. |:|.|..     |..|
  Rat   142 FRLFASIECEG-----QLFMTPYDFILAVTTDEPKFAKTWKSLSKQELSQMLSETP-----PVWK 196

  Fly    77 DDS-IFLKIEKRGLLTYSDYVLLTILLSIPERNVRISFKLFDLNGDGDVTIDE-----LDTVFMA 135
            ..| :|..:::||:::|::|:.|..:|:.|....||:|.:||.  ||:..:|:     |..:|..
  Rat   197 GSSKLFRNLKERGVISYTEYLFLLCILTKPHAGFRIAFNMFDT--DGNEMVDKKEFLVLQEIFRK 259

  Fly   136 MTQ-------------------GEVSMMNSHLKS------------------------------- 150
            ..:                   |..|..||.||.                               
  Rat   260 KNEKRETKGDEEKRAMLRLQLYGYHSPTNSVLKPDAEELVSRSYWDTLRRSTSQALFSDLAERAD 324

  Fly   151 -------------HFFGHRLNKTLSIDEFLKFLHALHIEIHTDQFQNLLKESSSVISELDFAKVV 202
                         ||||.:....|:.::|.:|:..|..|:...:|.: .....:.|||.|||.::
  Rat   325 DITSLVADTTLLVHFFGKKGKAELNFEDFYRFMDNLQTEVLEIEFLS-YSNGMNTISEEDFAHIL 388

  Fly   203 LGLRKSRSERREI-LKRVKKKFGQMDHGITLEEFLAFFRFVQDVSIMDNALAFYYFTGADISPKT 266
              ||.:..|...: |:.|:....: :.|||.:||.:||:|:.::.....||..|.|....|....
  Rat   389 --LRYTNVENTSVFLENVRYSIPE-EKGITFDEFRSFFQFLNNLEDFAIALNMYNFASRSIGQDE 450

  Fly   267 MRHIAYVVTGVKLSQHLTDVIFCIFDRNNDNIIQRKEFTDMRRQWMH 313
            .:...||.||:|||.||.:.:|.|||.:.|:.:..|||..:.:..:|
  Rat   451 FKRAVYVATGLKLSPHLVNTVFKIFDVDKDDQLSYKEFIGIMKDRLH 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4704NP_001287476.1 EFh 113..171 CDD:298682 21/125 (17%)
EF-hand_8 259..307 CDD:290545 18/47 (38%)
Micu3XP_006253262.1 EF-hand_8 442..495 CDD:290545 18/52 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2643
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D425365at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.