DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4704 and MICU3

DIOPT Version :9

Sequence 1:NP_001287476.1 Gene:CG4704 / 42706 FlyBaseID:FBgn0039029 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_859074.1 Gene:MICU3 / 286097 HGNCID:27820 Length:530 Species:Homo sapiens


Alignment Length:374 Identity:89/374 - (23%)
Similarity:160/374 - (42%) Gaps:95/374 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FRYFATIKMKNKSGKWELYMTPNDFLRSI---QPGLKQPENLGLDKFQILDEHAANKWIPEVK-- 76
            ||.||:|:.:.     :|:|||.||:.::   :|.:.:       .::.|.:...|:.:.|..  
Human   149 FRLFASIECEG-----QLFMTPYDFILAVTTDEPKVAK-------TWKSLSKQELNQMLAETPPV 201

  Fly    77 ---DDSIFLKIEKRGLLTYSDYVLLTILLSIPERNVRISFKLFDLNGDGDVTIDE-----LDTVF 133
               ...:|..::::|:::|::|:.|..:|:.|....||:|.:||.  ||:..:|:     |..:|
Human   202 WKGSSKLFRNLKEKGVISYTEYLFLLCILTKPHAGFRIAFNMFDT--DGNEMVDKKEFLVLQEIF 264

  Fly   134 MAMTQ-------------------GEVSMMNSHLKS----------------------------- 150
            ....:                   |..|..||.||:                             
Human   265 RKKNEKREIKGDEEKRAMLRLQLYGYHSPTNSVLKTDAEELVSRSYWDTLRRNTSQALFSDLAER 329

  Fly   151 ---------------HFFGHRLNKTLSIDEFLKFLHALHIEIHTDQFQNLLKESSSVISELDFAK 200
                           ||||.:....|:.::|.:|:..|..|:...:|.: .....:.|||.|||.
Human   330 ADDITSLVTDTTLLVHFFGKKGKAELNFEDFYRFMDNLQTEVLEIEFLS-YSNGMNTISEEDFAH 393

  Fly   201 VVLGLRKSRSERREI-LKRVKKKFGQMDHGITLEEFLAFFRFVQDVSIMDNALAFYYFTGADISP 264
            ::  ||.:..|...: |:.|:....: :.|||.:||.:||:|:.::.....||..|.|....|..
Human   394 IL--LRYTNVENTSVFLENVRYSIPE-EKGITFDEFRSFFQFLNNLEDFAIALNMYNFASRSIGQ 455

  Fly   265 KTMRHIAYVVTGVKLSQHLTDVIFCIFDRNNDNIIQRKEFTDMRRQWMH 313
            ...:...||.||:|.|.||.:.:|.|||.:.|:.:..|||..:.:..:|
Human   456 DEFKRAVYVATGLKFSPHLVNTVFKIFDVDKDDQLSYKEFIGIMKDRLH 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4704NP_001287476.1 EFh 113..171 CDD:298682 21/125 (17%)
EF-hand_8 259..307 CDD:290545 17/47 (36%)
MICU3NP_859074.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..115
PTZ00183 238..366 CDD:185503 23/129 (18%)
EF-hand_8 449..502 CDD:290545 17/52 (33%)
EF-hand_7 <452..499 CDD:290234 17/46 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2643
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D425365at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.