DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4704 and MICU2

DIOPT Version :9

Sequence 1:NP_001287476.1 Gene:CG4704 / 42706 FlyBaseID:FBgn0039029 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_689939.1 Gene:MICU2 / 221154 HGNCID:31830 Length:434 Species:Homo sapiens


Alignment Length:333 Identity:85/333 - (25%)
Similarity:150/333 - (45%) Gaps:62/333 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FRYFATIKMKNKSGKWELYMTPNDFLRSIQPGLKQPENLGLDKFQILDEHAANKWI--PEVKD-- 77
            |..|::::.:.     |.||||.|||.|:.             |:.::...:.|.:  .:::|  
Human    90 FMQFSSLEHEG-----EYYMTPRDFLFSVM-------------FEQMERKTSVKKLTKKDIEDTL 136

  Fly    78 ---------DSIFLKIEKRGLLTYSDYVLLTILLSIPERNVRISFKLFDLNGDGDVTI------- 126
                     .:.|..:..:||::|::|:.|..:|:.|.....::||:.|.  ||:..|       
Human   137 SGIQTAGCGSTFFRDLGDKGLISYTEYLFLLTILTKPHSGFHVAFKMLDT--DGNEMIEKREFFK 199

  Fly   127 --------DELDTVFMAMTQGEVSM-----MNSHLKSHFFGHRLNKTLSIDEFLKFLHALHIEIH 178
                    |:|.||....|..:.::     :|:.|:..|||.|..:.|...||.:|:..|..||.
Human   200 LQKIISKQDDLMTVKTNETGYQEAIVKEPEINTTLQMRFFGKRGQRKLHYKEFRRFMENLQTEIQ 264

  Fly   179 TDQFQNLLKESSSVISELDFAKVVLGLRKSRSERREIL-KRVKKKFGQMDHGITLEEFLAFFRFV 242
            ..:|....|..|.:..| |||:.:|..  :.:|.::|. |.|::|. .....|:|:||.:|..|.
Human   265 EMEFLQFSKGLSFMRKE-DFAEWLLFF--TNTENKDIYWKNVREKL-SAGESISLDEFKSFCHFT 325

  Fly   243 QDVSIMDNALAFYYFTGA--DISPKTMRHIAYVVTGVKLSQHLTDVIFCIFDRNNDNIIQRKEFT 305
              ..:.|.|:|...|:.|  .:.....:....|.||.:||.::.|.:|.|||.:.|..:..:||.
Human   326 --THLEDFAIAMQMFSLAHRPVRLAEFKRAVKVATGQELSNNILDTVFKIFDLDGDECLSHEEFL 388

  Fly   306 DMRRQWMH 313
            .:.:..||
Human   389 GVLKNRMH 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4704NP_001287476.1 EFh 113..171 CDD:298682 21/77 (27%)
EF-hand_8 259..307 CDD:290545 14/49 (29%)
MICU2NP_689939.1 EFh_MICU2 176..395 CDD:320082 61/226 (27%)
EF-hand motif 176..205 CDD:320082 6/30 (20%)
EF-hand motif 233..263 CDD:320082 10/29 (34%)
EF-hand motif 329..358 CDD:320082 6/28 (21%)
EF-hand motif 366..395 CDD:320082 8/28 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2643
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D425365at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.