DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4704 and micu2

DIOPT Version :9

Sequence 1:NP_001287476.1 Gene:CG4704 / 42706 FlyBaseID:FBgn0039029 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_002940795.2 Gene:micu2 / 100486652 XenbaseID:XB-GENE-994925 Length:431 Species:Xenopus tropicalis


Alignment Length:322 Identity:89/322 - (27%)
Similarity:153/322 - (47%) Gaps:40/322 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FRYFATIKMKNKSGKWELYMTPNDFLRSIQPGLKQPENLGLDKFQILDE-HAANKWIPEVKDDSI 80
            |..||::|.:.     |.||||.|||.|:.  .:|.|...:.|.....| .|......:.|..|:
 Frog    86 FMQFASLKYEG-----EYYMTPRDFLFSVM--FEQMERRTISKPLTKKELDAMLSQATKAKPGSM 143

  Fly    81 FLK-IEKRGLLTYSDYVLLTILLSIPERNVRISFKLFDLNGDGDVTIDE---LDTVF-----MAM 136
            |.: :..:||::|::|:.|..:|:.|:...||:|.:.|.:|:..|...|   |..:.     |.|
 Frog   144 FFRDLGDKGLISYTEYLFLLTILTKPQTGFRIAFNMLDTDGNEQVEKREFFKLQRILGHKEDMKM 208

  Fly   137 TQGEV----------SMMNSHLKSHFFGHRLNKTLSIDEFLKFLHALHIEIHTDQFQNLLKESSS 191
            :.|.|          |.:|:.|..||||....:.|...||.||:..|..|:...:|....|..:.
 Frog   209 SPGGVTSTQEPSTDSSDVNTTLLVHFFGRGGREKLQYSEFYKFMENLQTEVQEMEFIQFSKGLNF 273

  Fly   192 VISELDFAKVVLGLRKSRSERREIL-KRVKKKF--GQMDHGITLEEFLAFFRFVQDVSIMDNALA 253
            :..| |||:.:|..  :..|..::. :.|:.:.  |:   .|:::||.:|::|:.::.  |.::.
 Frog   274 MRKE-DFAEWLLFF--TDEENNDVYWQNVQARIPPGE---SISMDEFKSFYQFMNNLE--DFSIT 330

  Fly   254 FYYFTGAD--ISPKTMRHIAYVVTGVKLSQHLTDVIFCIFDRNNDNIIQRKEFTDMRRQWMH 313
            ...|:.|:  |.....:....|.||.:||.::.|.:|.|||.:.||.:...||..:.|..:|
 Frog   331 MKLFSSANRAIKMAEFKRAVKVATGQELSNNVLDTVFKIFDLDGDNCLSHGEFLGVLRNRLH 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4704NP_001287476.1 EFh 113..171 CDD:298682 22/75 (29%)
EF-hand_8 259..307 CDD:290545 16/49 (33%)
micu2XP_002940795.2 EFh_MICU2 172..391 CDD:320082 60/226 (27%)
EF-hand motif 172..201 CDD:320082 8/28 (29%)
EF-hand motif 229..259 CDD:320082 11/29 (38%)
EF-hand motif 325..354 CDD:320082 5/30 (17%)
EF-hand motif 362..391 CDD:320082 10/28 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D425365at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.