DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp12-46 and UBP7

DIOPT Version :9

Sequence 1:NP_651099.1 Gene:Usp12-46 / 42702 FlyBaseID:FBgn0039025 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_012110.1 Gene:UBP7 / 854650 SGDID:S000001418 Length:1071 Species:Saccharomyces cerevisiae


Alignment Length:561 Identity:108/561 - (19%)
Similarity:182/561 - (32%) Gaps:230/561 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NVSQLEREIGSDLFPPNEH----YFGLVNFGNTCYSNSVLQALYFCKPFREKVLEYKAK------ 58
            |:..:||.       ||.:    ..||.|.|||||.||::|.|:..|.||...:..|.|      
Yeast   592 NIPTIERS-------PNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSKYKSYLQPI 649

  Fly    59 -----NKRPKETLLSCLADLFYSIATQKKKVG--SIAPK---KFITRLRKEKEEFDNYMQQDAHE 113
                 :..||  |.:.|:.||..:...    |  |:.|.   |.|.:||.:.:..|:  |||..|
Yeast   650 RSNGSHYSPK--LSNSLSMLFNKMYLN----GGCSVVPTGFLKVINQLRPDLKIPDD--QQDTQE 706

  Fly   114 FLNFLINHINEIILAERNAGPSNGNPKATNQGGSTSAMASSIASKSSSTSNSNSNSNSTTNSNGN 178
            ||..|::.:::.:..:::.  :|..|             :.:...:.:...||:......:.|  
Yeast   707 FLMILLDRLHDELSDQQHV--ANDYP-------------NLLLYNADALKVSNNEYKHWFDKN-- 754

  Fly   179 SSNSTGSLNANTSVLDASGSLTATTTPIISGNGTGTNGANSEPTWVHEIFQGILTSETRCLNCET 243
                                        :.|||...         :.:||||.:.:..:|..|..
Yeast   755 ----------------------------VIGNGISP---------IDDIFQGQMENSLQCKRCGY 782

  Fly   244 VSSKDENFFDLQVDV--------------DQNTSITHCLRCFSNTETLCSDNKFKCDNC------ 288
            .:.....|:.|.:.:              ::...:..|:..|::.|.|..:|.:.|..|      
Yeast   783 TTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRCGPTASV 847

  Fly   289 ----------------------------------------------------------------- 288
                                                                             
Yeast   848 STSVSALENEPSIVKSKKKKSRFFTLHTGTKRRHLDFFGDGITEGHNSNNNNTTIFERERSRSPF 912

  Fly   289 --------------------------CSYQEAQ----KRMRVKKLPMILALHLKRFKY-MEQFNR 322
                                      ..|:..:    |.:....||.||.:||.||.| :.:.|.
Yeast   913 RMLGGSGKRSSSSTPFSTGGNDSNNSSDYKNKKLTTVKTINFVTLPKILVIHLSRFYYDLTKKNN 977

  Fly   323 HIKVSHRVVFPLELRLFNTSDDAVNPDRLYDLTAVVIHCGSGPNRGHYISIVK---SHGL----- 379
            .:     |.:||.|.:...::|.:.    |.|..||.|.|:..: |||.|:|.   .|.:     
Yeast   978 TV-----VTYPLILNIILKNNDTMK----YKLFGVVNHTGTLIS-GHYTSLVNKDLEHNVNIGRS 1032

  Fly   380 -WLLFDDDMVDKIEASTIEDFYGLTSDIHKSSETGYILFYQ 419
             |..|||::| |.:..     :|...::..||...|:|||:
Yeast  1033 KWYYFDDEVV-KADRK-----HGSDKNLKISSSDVYVLFYE 1067

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp12-46NP_651099.1 Peptidase_C19G 25..419 CDD:239128 102/534 (19%)
UBP7NP_012110.1 RHOD 328..443 CDD:197731
UCH 609..1066 CDD:395355 101/534 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.