DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp12-46 and USP38

DIOPT Version :9

Sequence 1:NP_651099.1 Gene:Usp12-46 / 42702 FlyBaseID:FBgn0039025 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_115946.2 Gene:USP38 / 84640 HGNCID:20067 Length:1042 Species:Homo sapiens


Alignment Length:572 Identity:126/572 - (22%)
Similarity:191/572 - (33%) Gaps:243/572 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GLVNFGNTCYSNSVLQALYFCKPFREKVLEYKAKNKRPKETLLSCLADLFYSIA-TQKKKVGSIA 88
            ||:|.|||||.|||:|||:....||.:||   :.|.....:|:..|..||..:| ||::   :.|
Human   446 GLINLGNTCYMNSVIQALFMATDFRRQVL---SLNLNGCNSLMKKLQHLFAFLAHTQRE---AYA 504

  Fly    89 PKKFITRLRKEKEEFDNYMQQDAHEFLNFLINHINE---IILAERNAGPSNGNPKATNQGGSTSA 150
            |:.|....|  ...|....|||..|:|.||::.::|   |:..:.:..||.     ..:...|| 
Human   505 PRIFFEASR--PPWFTPRSQQDCSEYLRFLLDRLHEEEKILKVQASHKPSE-----ILECSETS- 561

  Fly   151 MASSIASKSSSTSNSNSNSNSTTNSNGNSSNSTGSLNANTSVLDASGSLTATTTPIISGNGTGTN 215
             ...:|||::                                       ..|.||..|       
Human   562 -LQEVASKAA---------------------------------------VLTETPRTS------- 579

  Fly   216 GANSEPTWVHEIFQGILTSETRCLNCETVSSKDENFFDLQV------------------------ 256
              :.|.|.:.::|.|.|.:..|||||.:.|.|.|.|.||.:                        
Human   580 --DGEKTLIEKMFGGKLRTHIRCLNCRSTSQKVEAFTDLSLAFCPSSSLENMSVQDPASSPSIQD 642

  Fly   257 --------------------------------------------------------------DVD 259
                                                                          ||.
Human   643 GGLMQASVPGPSEEPVVYNPTTAAFICDSLVNEKTIGSPPNEFYCSENTSVPNESNKILVNKDVP 707

  Fly   260 Q------NTSITHCLRCFSNTETLCSDNKFKCDNCCSYQEAQKRMRVKKLPMILALHLKRFKYME 318
            |      ..|:|..|..|...|.|..||::.|:||.|.|.|:|.|::.:.|..|.|.|.||.|.:
Human   708 QKPGGETTPSVTDLLNYFLAPEILTGDNQYYCENCASLQNAEKTMQITEEPEYLILTLLRFSYDQ 772

  Fly   319 QFNRHIKVSHRVVFPLELRL-------FNTSDDAVNPD-------------------------RL 351
            :::...|:...|..||.|.|       |::..::.:.|                         :|
Human   773 KYHVRRKILDNVSLPLVLELPVKRITSFSSLSESWSVDVDFTDLSENLAKKLKPSGTDEASCTKL 837

  Fly   352 --YDLTAVVIHCGSGPNRGHYISIVK------------------------SHGL----------- 379
              |.|::||:|.|.....|||.|..:                        ||.|           
Human   838 VPYLLSSVVVHSGISSESGHYYSYARNITSTDSSYQMYHQSEALALASSQSHLLGRDSPSAVFEQ 902

  Fly   380 ----------WLLFDDDMVDKIEASTIEDFYGLTSDIHKSSETGYILFYQSR 421
                      |.||:|   .::..::.:....:||...|  :|.|:|.|:.:
Human   903 DLENKEMSKEWFLFND---SRVTFTSFQSVQKITSRFPK--DTAYVLLYKKQ 949

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp12-46NP_651099.1 Peptidase_C19G 25..419 CDD:239128 125/568 (22%)
USP38NP_115946.2 Peptidase_C19H 446..947 CDD:239129 125/568 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1864
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.