DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp12-46 and faf

DIOPT Version :9

Sequence 1:NP_651099.1 Gene:Usp12-46 / 42702 FlyBaseID:FBgn0039025 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_524612.2 Gene:faf / 43749 FlyBaseID:FBgn0005632 Length:2778 Species:Drosophila melanogaster


Alignment Length:493 Identity:109/493 - (22%)
Similarity:152/493 - (30%) Gaps:181/493 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PNEHYFGLVNFGNTCYSNSVLQALYFCKPFREKVLEYKAKNKRPKETL----------------- 66
            |.:.:.||.|.|.|||.|||||.||.....|..:|..........|..                 
  Fly  1663 PTKGFCGLKNAGATCYMNSVLQQLYMVPAVRVGILRAHGAATTDGEDFSGDSDLTGGGLGSALFS 1727

  Fly    67 --LSCLADLFYSIATQK---------------KKVGSI------------APKKFITRLRKEKEE 102
              .|.|..|..|.:|.:               |.|.:|            .|:...|..:...|.
  Fly  1728 GPASALVSLPSSSSTIEDGLHDVRKNYHVVILKHVQAIFAHLGHSALQYYVPRGLWTHFKLLGEP 1792

  Fly   103 FDNYMQQDAHEFLNFLINHINEIILAERNAGPSNGNPKATNQ--GGSTSAMASSIASKSSSTSNS 165
            .:...||||.||...|:..::|.:.|       .|.|:..|.  |||.|                
  Fly  1793 VNLREQQDAVEFFMSLLESLDEGLKA-------LGQPQLMNATLGGSFS---------------- 1834

  Fly   166 NSNSNSTTNSNGNSSNSTGSLNANTSVLDASGSLTATTTPIISGNGTGTNGANSEPTWVHEIFQG 230
                                                                             
  Fly  1835 ----------------------------------------------------------------- 1834

  Fly   231 ILTSETRCLNCETVSSKDENFFDLQVDVDQNTSITHCLRCFSNTETLCSDNKFKCDNCCSYQEAQ 295
               .:..|..|....||:|.|....||:..::|:|..|..:...|.|...:.:.||.|.......
  Fly  1835 ---DQKICQECPHRYSKEEPFSVFSVDIRNHSSLTESLEQYVKGELLEGADAYHCDKCDKKVVTV 1896

  Fly   296 KRMRVKKLPMILALHLKRFKYMEQFNRHIKVSHRVVFP---------------LELRLFNTSDDA 345
            ||:.|||||.:||:.||||:|..:....||.:....||               ||..:....|:.
  Fly  1897 KRVCVKKLPPVLAIQLKRFEYDYERVCAIKFNDYFEFPRILDMEPYTVSGLAKLEGEVVEVGDNC 1961

  Fly   346 -VNPDRL-YDLTAVVIHCGSGPNRGHYISIVKSHG------LWLLFDDDMVDKIEASTIE----- 397
             .|.:.. |:||.:|:|.|.. :.|||.|.:.|..      .|..|||..|.:.:....|     
  Fly  1962 QTNVETTKYELTGIVVHSGQA-SGGHYFSYILSKNPANGKCQWYKFDDGEVTECKMHEDEEMKAE 2025

  Fly   398 ----DFYGLTSDIH---------KSSETGYILFYQSRD 422
                ::.|.|.|.:         |.....|:|||...|
  Fly  2026 CFGGEYMGETYDNNLKRMQYRRQKRWWNAYMLFYTRCD 2063

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp12-46NP_651099.1 Peptidase_C19G 25..419 CDD:239128 106/482 (22%)
fafNP_524612.2 peptidase_C19C 1666..2064 CDD:239124 108/490 (22%)
UCH 1668..2059 CDD:278850 105/482 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24006
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.