DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp12-46 and Usp1

DIOPT Version :9

Sequence 1:NP_651099.1 Gene:Usp12-46 / 42702 FlyBaseID:FBgn0039025 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001015015.1 Gene:Usp1 / 313387 RGDID:1306461 Length:784 Species:Rattus norvegicus


Alignment Length:542 Identity:123/542 - (22%)
Similarity:194/542 - (35%) Gaps:175/542 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ANVSQLEREIGSDLFPPNEHYFGLVNFGNTCYSNSVLQALYFCKPFREKVLEYKAKNKRPKETLL 67
            |..|.:..|...:|.|    :.||.|.|||||.||:||.||||..|:..|........|.||.|.
  Rat    64 AQSSPVSCEKRENLLP----FVGLNNLGNTCYLNSILQVLYFCPGFKAGVKHLFNIISRKKEALK 124

  Fly    68 ---------SCLADLFYS---------------------IATQKKKVGSIA--PKKFITRLRKEK 100
                     ||..|...|                     :...:|....:|  |::.:..||:..
  Rat   125 DDSIQKDKGSCKEDPLASYELICSLQSLIISVEQLQASFLLNPEKYTDELATQPRRLLNTLRELN 189

  Fly   101 EEFDNYMQQDAHEFLNFLINHINEI-----------------------ILAERNAGPSN------ 136
            ..::.|:|.||.|.|..::.:|.|.                       :..|...|.|:      
  Rat   190 PMYEGYLQHDAQEVLQCILGNIQETCQLLKKEEIKNLTEFSSKVEEKSLQKEETGGISSTETDST 254

  Fly   137 ------------GNPKATNQG--------------------------------GSTSAMASSIAS 157
                        ||.|..:.|                                |.|...:..|..
  Rat   255 RNLDDLKEQLPKGNWKRKSDGESGNMKKKVKLSRESQPLEENQRQTRSKRKATGDTLEASPKIIP 319

  Fly   158 KSSSTSNSNSNSNS----------------------------TTN--SNGNSSNSTGSL------ 186
            |..|.:.|...|..                            |||  |.|....:.|.|      
  Rat   320 KCVSENESAKPSQKKSKVKINWLKPATKQPSILSKFCSLGKITTNQRSKGQPKVNEGDLEEDLEK 384

  Fly   187 NANTSVLDASG--SLTATTTPIISGNGTGTNGANSEPTW--VHEIFQGILTSETRCLNCETVSSK 247
            :...:.::.||  |..::.||:.|......|....:..:  |.::|||.|...||||.||:::.:
  Rat   385 DGRDNTVNGSGPASPGSSVTPVDSSEAKSINKGAEQIGFELVEKLFQGQLVLRTRCLECESLTER 449

  Fly   248 DENFFDLQVDVDQN-------------------TSITHCLRCFSNTETLCSDNKFKCDNCCSYQE 293
            .|:|.|:.|.|.::                   .::...:..|::.|.:..::|:.|:||..|.|
  Rat   450 REDFQDISVPVQEDELSKVEESSEISPEPKTEMKTLRWAISQFASVERIVGEDKYFCENCHHYTE 514

  Fly   294 AQKRMRVKKLPMILALHLKRFKYME-QFNRH----IKVSHRVVFPLELRLFNTSDDAVNPDRLYD 353
            |::.:...|:|.::.:|||.|.... :|:.:    .|::..::.||:|.|...|....|..  |.
  Rat   515 AERSLLFDKMPEVITIHLKCFAASGLEFDCYGGGLSKINTPLLTPLKLSLEEWSTKPTNDS--YG 577

  Fly   354 LTAVVIHCGSGPNRGHYISIVK 375
            |.|||:|.|...:.|||.:.||
  Rat   578 LFAVVMHSGITISSGHYTASVK 599

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp12-46NP_651099.1 Peptidase_C19G 25..419 CDD:239128 118/520 (23%)
Usp1NP_001015015.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 33..54
Peptidase_C19 82..>253 CDD:271592 42/170 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 232..341 14/108 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 363..411 12/47 (26%)
Peptidase_C19O <424..599 CDD:239136 49/176 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 686..723
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1864
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24006
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.