DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp12-46 and Usp35

DIOPT Version :9

Sequence 1:NP_651099.1 Gene:Usp12-46 / 42702 FlyBaseID:FBgn0039025 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_238899.4 Gene:Usp35 / 308834 RGDID:1565984 Length:1007 Species:Rattus norvegicus


Alignment Length:559 Identity:114/559 - (20%)
Similarity:174/559 - (31%) Gaps:246/559 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GLVNFGNTCYSNSVLQALYFCKPFREKVLEYKAKNKRPKETLLSCLADLFYSIATQKKKVGSIAP 89
            ||:|.|||||.|||||||:....||..||.....|.:|   |::.|..||..:...::.  :|:|
  Rat   442 GLINLGNTCYVNSVLQALFMASDFRHCVLRLTENNSQP---LMTKLQWLFAFLEHSQRP--AISP 501

  Fly    90 KKFITRLRKEKEEFDNYMQQDAHEFLNFLINHINEIILAERNAGPSNGNPKATNQGGSTSAMASS 154
            :.|::  ......|....|||..|:|.:|::.::|    |...|                   :.
  Rat   502 ENFLS--ASWTPWFSPGTQQDCSEYLKYLLDRLHE----EEKTG-------------------TR 541

  Fly   155 IASKSSSTSNSNSNSNSTTNSNGNSSNSTGSLNANTSVLDASGSLTATTTPIISGNGTGTNGANS 219
            |..|...:                                   ||.:....:.|.|.|.      
  Rat   542 ICQKLKQS-----------------------------------SLPSPQEELPSSNATS------ 565

  Fly   220 EPTWVHEIFQGILTSETRCLNCETVSSKDENFFDLQV---------------------DV-DQNT 262
                |..:|.|.:.:...||:|..|||::|.|.||.:                     || .|..
  Rat   566 ----VERMFGGKIVTRICCLHCLNVSSREEAFTDLSLAFPPPERSRHRRLGSVMLPTEDVRAQEL 626

  Fly   263 SIT-----------HCL------------------------------------------------ 268
            ::.           ||:                                                
  Rat   627 TLAPRAPGAQRQRKHCITGDAPRTGLDIEGVDTVGNGGQSGQEKVEREQAGKEKEVAEDREEEGP 691

  Fly   269 --------------------------------------------------RC------------- 270
                                                              .|             
  Rat   692 REEEKEEGEEKDKEKKEDEKEKEAEDGKEKEGDSLGPGTRKDAATPPREQACGPEGSRSVLDLVN 756

  Fly   271 -FSNTETLCSDNKFKCDNCCSYQEAQKRMRVKKLPMILALHLKRFKYMEQFNRHIKVSHRVVFPL 334
             |.:.|.|.::|::.|::|.|.|:|:|.:.:.:.|..|.|.|.||.:..:..|..|:...|..||
  Rat   757 YFLSPERLTAENRYYCESCASLQDAEKVVELSQGPCYLILTLLRFSFDLRTMRRRKILDDVTIPL 821

  Fly   335 ELRLFNTSDDAVNPDRLYDLTAVVIHCGSGPNRGHYISIVKS-----------------HGLWLL 382
            .|||    ..|....:.|||.:||:|.|.....|||....:.                 ...|.|
  Rat   822 LLRL----PLAGGQGQAYDLCSVVVHSGVSSESGHYYCYAREGAARPAPVLGSTERPEPENQWYL 882

  Fly   383 FDDDMVDKIEASTIEDFYGLTSDIHKSSETGYILFYQSR 421
            |:|   .::..|:.|....:||...|  :|.|:|||:.|
  Rat   883 FND---TRVSFSSFESVSNVTSFFPK--DTAYVLFYRQR 916

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp12-46NP_651099.1 Peptidase_C19G 25..419 CDD:239128 112/555 (20%)
Usp35XP_238899.4 UCH 441..913 CDD:278850 111/554 (20%)
Peptidase_C19 442..914 CDD:271592 112/555 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1864
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.