DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp12-46 and Usp38

DIOPT Version :9

Sequence 1:NP_651099.1 Gene:Usp12-46 / 42702 FlyBaseID:FBgn0039025 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001100888.2 Gene:Usp38 / 307764 RGDID:1311974 Length:1041 Species:Rattus norvegicus


Alignment Length:573 Identity:131/573 - (22%)
Similarity:191/573 - (33%) Gaps:244/573 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GLVNFGNTCYSNSVLQALYFCKPFREKVLEYKAKNKRPKETLLSCLADLFYSIA-TQKKKVGSIA 88
            ||:|.|||||.|||||||:....||.:||   :.|.....:|:..|..||..:| ||::   :.|
  Rat   446 GLINLGNTCYMNSVLQALFMATEFRRQVL---SLNLNGCNSLMKKLQHLFAFLAHTQRE---AYA 504

  Fly    89 PKKFITRLRKEKEEFDNYMQQDAHEFLNFLINHINE---IILAERNAGPSNGNPKATNQGGSTSA 150
            |:.|....|  ...|....|||..|:|.||::.::|   |:..:.:..||.|.       |.|..
  Rat   505 PRIFFEASR--PPWFTPRSQQDCSEYLRFLLDRLHEEEKILRIQSSHKPSEGL-------GCTET 560

  Fly   151 MASSIASKSSSTSNSNSNSNSTTNSNGNSSNSTGSLNANTSVLDASGSLTATTTPIISGNGTGTN 215
            ....:.:|.:..|.|.|                                            ||  
  Rat   561 CLQEVTNKVAVPSESPS--------------------------------------------TG-- 579

  Fly   216 GANSEPTWVHEIFQGILTSETRCLNCETVSSKDENFFDLQV------------------------ 256
              .||.|.:.::|.|.|.:...||||.:.|.|.|.|.||.:                        
  Rat   580 --GSEKTLIEKMFGGKLRTHICCLNCRSTSHKVEAFTDLSLAFCPSPSVEDSSFQDPASLPSAQD 642

  Fly   257 --------------------------------------------------------------DVD 259
                                                                          ||.
  Rat   643 DGLMQTSVTDAEEEPVVCNPAAAAFVCDSVVNERRLGSPPVEFPCAKNSSVPGESAKILVSKDVP 707

  Fly   260 QN------TSITHCLRCFSNTETLCSDNKFKCDNCCSYQEAQKRMRVKKLPMILALHLKRFKYME 318
            ||      ||:|..|..|...|.|..:|::.|::|.|.|.|:|.|::.:.|..|.|.|.||.|.:
  Rat   708 QNPGGESTTSVTDLLNYFLAPEVLTGENQYYCESCASLQNAEKTMQITEEPEYLILTLLRFSYDQ 772

  Fly   319 QFNRHIKVSHRVVFP--LELRLFNTS------------------------------DDAVNPDRL 351
            :::...|:...|..|  |||.:..||                              ::|..|..:
  Rat   773 KYHVRRKILDNVSLPLVLELPVKRTSLSSLSEGWSADADFTDVNENLAKKLKPSGTEEAFCPKLV 837

  Fly   352 -YDLTAVVIHCGSGPNRGHYISIVK--------------SHGL---------------------- 379
             |.|::||:|.|.....|||.|..:              |..|                      
  Rat   838 PYLLSSVVVHSGVSSESGHYYSYARNITGTESSYQMRPQSESLSLTPSQSSLLGGESPNTVIEQD 902

  Fly   380 ---------WLLFDDDMVDKIEASTIEDFYGLTSDIHKSSETGYILFY--QSR 421
                     |.||:|   .::..::.:....:||...|  :|.|:|||  |||
  Rat   903 LENKEMSQEWFLFND---SRVTFTSFQSVQKITSRFPK--DTAYVLFYKKQSR 950

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp12-46NP_651099.1 Peptidase_C19G 25..419 CDD:239128 128/569 (22%)
Usp38NP_001100888.2 Peptidase_C19H 446..946 CDD:239129 127/567 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.