DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nepl15 and CG32762

DIOPT Version :9

Sequence 1:NP_651098.2 Gene:Nepl15 / 42701 FlyBaseID:FBgn0039024 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_001284894.1 Gene:CG32762 / 318198 FlyBaseID:FBgn0052762 Length:200 Species:Drosophila melanogaster


Alignment Length:198 Identity:32/198 - (16%)
Similarity:61/198 - (30%) Gaps:65/198 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CAIDASVPHPLAANYSIDILRLAKAAHIKAYMGDEKEQACNNFYNYACANWPRLH---PARKSKT 79
            |....::.|.:.||    :||..:...      ..::..|.|......||....:   |||    
  Fly    65 CQRFENICHLMLAN----VLRQPEGVR------HTRDIDCRNVRGTGAANRRPCYNPCPAR---- 115

  Fly    80 RTNYLEELQELYIRKSADMLKSATRGAENSADRQLKYFYGSCRLQTNDTRSALNTLQNVTDFRGG 144
                     .:..::|....:...|..:|   ||.|....||:|:..:..|              
  Fly   116 ---------PVVCKRSPPSQQICVRSRDN---RQCKVLANSCQLRNQNCHS-------------- 154

  Fly   145 WPEIRVASWYQYEYDWLQVVANLKRKLGVDIFIGLEVILDYKEEKMHRLKIGAPQFPMSRRHYLH 209
                      |...:||:..   :|:.|.         |...::..:.:::.....|...:|:..
  Fly   155 ----------QPRNNWLRTD---RRRCGQ---------LQLGDKPQNCIRVPVRPRPTRAQHHST 197

  Fly   210 PHF 212
            .|:
  Fly   198 QHY 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nepl15NP_651098.2 M13 57..684 CDD:189000 26/159 (16%)
PepO 57..677 CDD:226118 26/159 (16%)
CG32762NP_001284894.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.