DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nepl13 and CG32762

DIOPT Version :9

Sequence 1:NP_651096.1 Gene:Nepl13 / 42699 FlyBaseID:FBgn0039022 Length:741 Species:Drosophila melanogaster
Sequence 2:NP_001284894.1 Gene:CG32762 / 318198 FlyBaseID:FBgn0052762 Length:200 Species:Drosophila melanogaster


Alignment Length:145 Identity:32/145 - (22%)
Similarity:54/145 - (37%) Gaps:26/145 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   380 GGYILYVALNELNQPPEEAP-----SQRARQC---VQVTQRLFPQVLGEMFQRHVQR-DNAKHDL 435
            |..:|:...:...|||...|     ....|.|   .||..:..|:|.|...:...|| :|..|  
  Fly    11 GMTLLWSMASGTTQPPSRRPPVTTARTTPRNCPLFPQVCSQTSPRVCGRTARGECQRFENICH-- 73

  Fly   436 DAVFNDVIKALEEQFHVEWMDENDRR---AARTRLSQYRVSLPDYQSLDLTDLQFQKSEDYWRRL 497
             .:..:|::..|...|...:|..:.|   ||..|        |.|.......:..::|..   ..
  Fly    74 -LMLANVLRQPEGVRHTRDIDCRNVRGTGAANRR--------PCYNPCPARPVVCKRSPP---SQ 126

  Fly   498 EIALKYRSHQQFEAL 512
            :|.::.|.::|.:.|
  Fly   127 QICVRSRDNRQCKVL 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nepl13NP_651096.1 PepO 63..732 CDD:226118 32/145 (22%)
M13 68..738 CDD:189000 32/145 (22%)
CG32762NP_001284894.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.