DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nepl13 and nep-4

DIOPT Version :9

Sequence 1:NP_651096.1 Gene:Nepl13 / 42699 FlyBaseID:FBgn0039022 Length:741 Species:Drosophila melanogaster
Sequence 2:NP_509156.2 Gene:nep-4 / 183746 WormBaseID:WBGene00016896 Length:437 Species:Caenorhabditis elegans


Alignment Length:223 Identity:48/223 - (21%)
Similarity:81/223 - (36%) Gaps:63/223 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   545 GLLQAPYYNYYYP-----KSLKYALLGHRLASALVQAFDDEGWNNHPQATAQWNEVTMSGYRNAS 604
            |.:...:.|||:.     ::.|....|.|:...:...|.:...|  |.....::       :.|.
 Worm   243 GTIYFGFPNYYHTTYGNWRASKLGYTGTRVGHEIGHTFIEHSIN--PDGLPYFS-------KPAE 298

  Fly   605 ECQRAQY------------------SSYLYNEPGEFRNATRLREIIADGSGLNLAFNAYLAWLEQ 651
            :|.:.||                  |.|.:::.|            ||..||.||:    |.||:
 Worm   299 DCVQNQYLKTCNEYYEGEVPDACNTSDYTFDDNG------------ADVFGLQLAY----AILER 347

  Fly   652 Q-DHKLRPLLAKETLSELNFTNTQLFFIYFAQTRCWAKDNQDAILDSMPLMQHTPERWDVNGPLS 715
            . ..:||     |....|..||.||.|..||...|  :.::....|.    .|:.....:|. ::
 Worm   348 DLSDQLR-----EQADGLKITNEQLLFYSFAYRFC--RGSKSNTTDG----SHSHHNVRINA-VA 400

  Fly   716 NSAEFGREFGCALGTPM--NSGDKCLVY 741
            ....|.:.|.||..:.|  ::..:|::|
 Worm   401 QMPGFQQAFNCASDSRMMKSATKQCVIY 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nepl13NP_651096.1 PepO 63..732 CDD:226118 45/210 (21%)
M13 68..738 CDD:189000 46/218 (21%)
nep-4NP_509156.2 GluZincin 250..425 CDD:387391 45/211 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.