DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17141 and NUG1

DIOPT Version :9

Sequence 1:NP_651094.2 Gene:CG17141 / 42697 FlyBaseID:FBgn0039020 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_010921.1 Gene:NUG1 / 856723 SGDID:S000000808 Length:520 Species:Saccharomyces cerevisiae


Alignment Length:296 Identity:82/296 - (27%)
Similarity:127/296 - (42%) Gaps:49/296 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DCIVEIHDARIPLAGRNSQFFDTITGSGVKPHILVLNKVDLLGAKQQKSVLQQLRRQQPELQHIL 106
            |.|:.:.|||.|.:.|:.:..:.:..|..|..||:||||||:.....:..|..|:...|.:.   
Yeast   177 DVILYVLDARDPESTRSRKVEEAVLQSQGKRLILILNKVDLIPPHVLEQWLNYLKSSFPTIP--- 238

  Fly   107 FTNCKDQRNNGV-----LDILPLATRLVSESSRFNRTQAAEHNLM--IIGVPNVGKSSVINVLRN 164
             ........||.     |.....|:.|:.....::.....:.:::  :||.||||||||||.|..
Yeast   239 -LRASSGAVNGTSFNRKLSQTTTASALLESLKTYSNNSNLKRSIVVGVIGYPNVGKSSVINALLA 302

  Fly   165 VHLKKKSAARVGAEAGITRSVGERIKIQENPPVYMIDTPGILQPSIKDD----EMGMKLALVGCL 225
            ....:..|..||.|||:|.|:.| |||...  :.::|:|||..||....    |...:|||:..|
Yeast   303 RRGGQSKACPVGNEAGVTTSLRE-IKIDNK--LKILDSPGICFPSENKKRSKVEHEAELALLNAL 364

  Fly   226 P-DHIVGEDLIADYLLYWLNSHRKYDYVEMLKLSSGPSDDISAVLAEY-------AHREELFHK- 281
            | .|||.                .|..|.||......||:::....:.       |:..:.|.| 
Yeast   365 PAKHIVD----------------PYPAVLMLVKRLAKSDEMTESFKKLYEIPPIPANDADTFTKH 413

  Fly   282 ----VKQYDGRVEV--MTNLLAAARKFIHFFRSGQL 311
                |.:..||:..  :.||.:|....::.:|.|::
Yeast   414 FLIHVARKRGRLGKGGIPNLASAGLSVLNDWRDGKI 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17141NP_651094.2 GTPase_YlqF 20..317 CDD:274669 82/296 (28%)
YlqF 22..206 CDD:206749 53/170 (31%)
NUG1NP_010921.1 GN3L_Grn1 15..88 CDD:400856
RbgA 162..481 CDD:224083 82/296 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.