DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17141 and NOG2

DIOPT Version :9

Sequence 1:NP_651094.2 Gene:CG17141 / 42697 FlyBaseID:FBgn0039020 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_014451.1 Gene:NOG2 / 855789 SGDID:S000005336 Length:486 Species:Saccharomyces cerevisiae


Alignment Length:207 Identity:58/207 - (28%)
Similarity:100/207 - (48%) Gaps:21/207 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NAFRLPSKQRINWFPGHMTKGMRQIQQKLRNVDCIVEIHDARIPLAGRNSQFFDTITGSGVKPHI 74
            |.:...:|:.| :..|...:...::.:.:.:.|.::.:.|||.||..|.....:.:.......|:
Yeast   192 NGWTSAAKEAI-FSKGQSKRIWNELYKVIDSSDVVIHVLDARDPLGTRCKSVEEYMKKETPHKHL 255

  Fly    75 L-VLNKVDLLGAKQQKSVLQQLRRQQPELQ-HILFTNCKDQRNNGVLDILPLATRLVSESSRFNR 137
            : ||||.||:......:.::.|.:::|.|. |...||   ....|.|      .:|:.:.|:.: 
Yeast   256 IYVLNKCDLVPTWVAAAWVKHLSKERPTLAFHASITN---SFGKGSL------IQLLRQFSQLH- 310

  Fly   138 TQAAEHNLMIIGVPNVGKSSVINVLRNVHLKKKSAARVGAEAGITRSVGERIKIQENPPVYMIDT 202
            |...:.::..||.||.||||:||.||     ||...:|....|.|: |.:.|.:.:.  :::||.
Yeast   311 TDRKQISVGFIGYPNTGKSSIINTLR-----KKKVCQVAPIPGETK-VWQYITLMKR--IFLIDC 367

  Fly   203 PGILQPSIKDDE 214
            |||:.||.||.|
Yeast   368 PGIVPPSSKDSE 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17141NP_651094.2 GTPase_YlqF 20..317 CDD:274669 56/197 (28%)
YlqF 22..206 CDD:206749 49/185 (26%)
NOG2NP_014451.1 NGP1NT 41..171 CDD:400461
NGP_1 214..370 CDD:206751 47/173 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.