DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17141 and EMB3129

DIOPT Version :9

Sequence 1:NP_651094.2 Gene:CG17141 / 42697 FlyBaseID:FBgn0039020 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_192188.2 Gene:EMB3129 / 828174 AraportID:AT4G02790 Length:372 Species:Arabidopsis thaliana


Alignment Length:325 Identity:89/325 - (27%)
Similarity:158/325 - (48%) Gaps:75/325 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 INWFPGHMTKGMRQIQQKLRNVDCIVEIHDARIPLAGRNSQFFDTITGSGVKPHILVLNKVDLLG 84
            :.|:|||:.|..::::::|:.:|.::|:.||||||:..:.: .|...|:  :..|||||:.|::.
plant    96 VQWYPGHIMKTEKELREQLKLMDVVIEVRDARIPLSTTHPK-MDAWLGN--RKRILVLNREDMIS 157

  Fly    85 AKQQKSVLQQLRRQQPELQHILFTNCKDQRNNGVLDILPLATRLVSESSRFNRTQAAEHNLM--- 146
            ...:....:...:|..:   ::|||.|  ...|.:.:..||..|..:.:...|    |..|:   
plant   158 NDDRNDWARYFAKQGIK---VIFTNGK--LGMGAMKLGRLAKSLAGDVNGKRR----EKGLLPRS 213

  Fly   147 ----IIGVPNVGKSSVINVLRNVHLKKKSAARVGAEAGITRSVGERIKIQENPPVYMIDTPGILQ 207
                |||.|||||||:||.|    ||:|..| .....|:||.: :.:|:.::  :.::|:||:|.
plant   214 VRAGIIGYPNVGKSSLINRL----LKRKICA-AAPRPGVTREM-KWVKLGKD--LDLLDSPGMLP 270

  Fly   208 PSIKDDEMGMKLALVGCLPDHIVGEDLIADYLLYWLNSHRKYDYVEMLKLSSGPSDDISAVLAEY 272
            ..|.|....:|||:  |  |.| ||              :.||:.           |::.:|.:.
plant   271 MRIDDQAAAIKLAI--C--DDI-GE--------------KAYDFT-----------DVAGILVQM 305

  Fly   273 AHR------EELFHKVK-QYDGR-----VEVM-TNLLA-----AARKFIHFFRSGQLGHMNLDEP 319
            ..|      :.|:::.| |.:|.     |:.: .||..     ||.:.:..||.|:.|:::|:.|
plant   306 LARIPEVGAKALYNRYKIQLEGNCGKKFVKTLGLNLFGGDSHQAAFRILTDFRKGKFGYVSLERP 370

  Fly   320  319
            plant   371  370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17141NP_651094.2 GTPase_YlqF 20..317 CDD:274669 87/321 (27%)
YlqF 22..206 CDD:206749 58/190 (31%)
EMB3129NP_192188.2 rbgA 97..371 CDD:236570 89/324 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D583045at2759
OrthoFinder 1 1.000 - - FOG0003800
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101533
Panther 1 1.100 - - O PTHR45782
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.