DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17141 and gnl1

DIOPT Version :9

Sequence 1:NP_651094.2 Gene:CG17141 / 42697 FlyBaseID:FBgn0039020 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001070721.1 Gene:gnl1 / 568505 ZFINID:ZDB-GENE-060323-1 Length:602 Species:Danio rerio


Alignment Length:310 Identity:74/310 - (23%)
Similarity:107/310 - (34%) Gaps:97/310 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PG------HMTKGMRQIQQKLRNVDCIVEIHDARIPLAGRNSQFFDTITGSGVKPHILVLNKVDL 82
            ||      |..:..||:.:.:...|.|:.|.|.|.|:.......:..||....|..||||||.||
Zfish   161 PGTLSHFEHNLETWRQLWRVIEMSDVILLIVDIRHPVLQFPPALYHYITEELKKHIILVLNKADL 225

  Fly    83 LGAKQQKSVLQQLRRQQPELQHILFTNCKDQ------------------RNNGVLDILPLATR-- 127
            ..|....:....|.:|.|.|..:.||:...|                  ...|.:.|:.:...  
Zfish   226 CPAPLVLAWKDYLTKQFPHLHCVCFTSHPGQPYSTLLQKKRMRKKAGWNHAGGPIHIMRVCQEIT 290

  Fly   128 -----LVSESSRFNRTQAA-----------------EHN---------------------LMIIG 149
                 |.|...:..|...|                 ||:                     |..||
Zfish   291 AGRVDLSSWEKKIQRDAVAVGNEGDRADDGSESVLMEHHSDIAMEMNSPTQELYKDGVLTLGCIG 355

  Fly   150 VPNVGKSSVINVLRNVHLKKKSAARVGAE-AGITRSVGERIKIQE---NPPVYMIDTPGILQPSI 210
            .||||||||:|.|            ||.: ..::|:.|.....|.   .|.|.:.|.||::.||.
Zfish   356 FPNVGKSSVLNSL------------VGRKVVSVSRTPGHTKYFQTYYLTPTVKLCDCPGLVFPSR 408

  Fly   211 KDDEMGMKLALVGCLPDHIVGEDLIADYLLYWLNSH--RKYDYVEMLKLS 258
            .|.::.:   |.|..|...:.|.       |....|  .:.:|:.:|||:
Zfish   409 VDKQLQV---LAGIYPVSQLQEP-------YSSVGHLCERTNYLSILKLT 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17141NP_651094.2 GTPase_YlqF 20..317 CDD:274669 74/310 (24%)
YlqF 22..206 CDD:206749 61/254 (24%)
gnl1NP_001070721.1 HSR1_MMR1 173..406 CDD:206750 58/244 (24%)
rbgA 175..508 CDD:236570 71/296 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.