Sequence 1: | NP_651094.2 | Gene: | CG17141 / 42697 | FlyBaseID: | FBgn0039020 | Length: | 323 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_060855.2 | Gene: | LSG1 / 55341 | HGNCID: | 25652 | Length: | 658 | Species: | Homo sapiens |
Alignment Length: | 426 | Identity: | 80/426 - (18%) |
---|---|---|---|
Similarity: | 132/426 - (30%) | Gaps: | 175/426 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 RNAFRLPSKQRINWFPGHMTKGM-RQIQQKLRNVDCIVEIHDARIPLAGRNSQFFDTITGSGV-K 71
Fly 72 PHILVLNKVDLLGAKQQKSVLQQLRRQ-------------------------------------- 98
Fly 99 ----QPELQH------------------------ILFTNC-----------------------KD 112
Fly 113 QRNNGVLDILPLATRLVSES-SRFNRTQAAEHNLM-----------------------------I 147
Fly 148 IGVPNVGKSSVIN-VLRNVHLKKKSAARVGAEAGITRSVGERIKIQENPPVYMIDTPGILQPSIK 211
Fly 212 DDEMGMKLALVGCLP-----DHIVGEDLIADYL-------LYWLN---------SHR-------- 247
Fly 248 -KYDYVEMLKLSSG-PSDDISA--VLAEYAHREELF 279 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17141 | NP_651094.2 | GTPase_YlqF | 20..317 | CDD:274669 | 76/415 (18%) |
YlqF | 22..206 | CDD:206749 | 54/305 (18%) | ||
LSG1 | NP_060855.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..31 | ||
RbgA | 151..554 | CDD:224083 | 76/416 (18%) | ||
HSR1_MMR1 | 163..444 | CDD:206750 | 53/298 (18%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 250..355 | 10/113 (9%) | |||
P-loop_NTPase | 366..>404 | CDD:304359 | 8/37 (22%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 623..658 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1161 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |