DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17141 and GNL3L

DIOPT Version :9

Sequence 1:NP_651094.2 Gene:CG17141 / 42697 FlyBaseID:FBgn0039020 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001171748.1 Gene:GNL3L / 54552 HGNCID:25553 Length:582 Species:Homo sapiens


Alignment Length:220 Identity:66/220 - (30%)
Similarity:97/220 - (44%) Gaps:49/220 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QRINWFPGHMTKGMRQIQQK-LRNV----DCIVEIHDARIPLAGRNSQFFDTI-TGSGVKPHILV 76
            |.:|.||....:..|:...| .|.|    |.|:|:.|||.||..|..|..:.: ...|.|..:||
Human   107 QELNMFPQLDDEATRKAYYKEFRKVVEYSDVILEVLDARDPLGCRCFQMEEAVLRAQGNKKLVLV 171

  Fly    77 LNKVDLLGAKQQKSVLQQLRRQQPEL------QHILFTNCKDQRNNGVLDILPLATRLVSESSRF 135
            |||:||:..:..:..|..||.:.|.:      ||        |..|  |:...:.....|||...
Human   172 LNKIDLVPKEVVEKWLDYLRNELPTVAFKASTQH--------QVKN--LNRCSVPVDQASESLLK 226

  Fly   136 NRTQAAEHNLM-------------------IIGVPNVGKSSVINVLRNVHLKKKSAARVGAEAGI 181
            ::......|||                   ::|:|||||||:||     .||:..|..|||..||
Human   227 SKACFGAENLMRVLGNYCRLGEVRTHIRVGVVGLPNVGKSSLIN-----SLKRSRACSVGAVPGI 286

  Fly   182 TRSVGERIKIQENPPVYMIDTPGIL 206
            |:.:.|   :..:..:.::|.|||:
Human   287 TKFMQE---VYLDKFIRLLDAPGIV 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17141NP_651094.2 GTPase_YlqF 20..317 CDD:274669 65/218 (30%)
YlqF 22..206 CDD:206749 63/214 (29%)
GNL3LNP_001171748.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58
Required for nucleolar localization 9..35
Nucleostemin_like 136..307 CDD:206753 56/188 (30%)
MnmE_helical 251..>405 CDD:331155 24/66 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.