DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17141 and gnl3l

DIOPT Version :9

Sequence 1:NP_651094.2 Gene:CG17141 / 42697 FlyBaseID:FBgn0039020 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001002875.1 Gene:gnl3l / 442932 ZFINID:ZDB-GENE-040723-1 Length:565 Species:Danio rerio


Alignment Length:305 Identity:79/305 - (25%)
Similarity:133/305 - (43%) Gaps:69/305 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RQIQQKLRNVDCIVEIHDARIPLAGRNSQFFDTITGSGV-KPHILVLNKVDLLGAKQQKSVLQQL 95
            |:.::.:...|.|:|:.|||.||..|..|....:..||. |..:|||||:||:.....:..::.|
Zfish   117 REFKKVIEAADVILEVLDARDPLGCRCPQVEQAVVQSGTNKKIVLVLNKIDLVSKDIVEKWIKYL 181

  Fly    96 RRQQPELQHILFTNCKDQRNNGV-LDILPL--ATRLVSESS-------------RFNRTQAAEHN 144
            |.:.|.   :.|.:...|:|..: ...:|:  ||:.:.|||             .:.|.|..:..
Zfish   182 RNEFPT---VAFKSSTQQQNKNLKRSRVPVTQATQELLESSACVGADCLMKLLGNYCRNQDIKTA 243

  Fly   145 LM--IIGVPNVGKSSVINVLRNVHLKKKSAARVGAEAGITRSVGE-----RIKIQENPPVYMI-- 200
            :.  ::|.|||||||:||     .||:..|..|||..|:|:.:.|     .||:.:.|.:.|.  
Zfish   244 ITVGVVGFPNVGKSSLIN-----SLKRARACNVGATPGVTKCLQEVHLDKHIKLLDCPGIVMATS 303

  Fly   201 --DTPGILQPSIKDDEM-----GMKLALVGCLPDHIVGEDLIADYLLYWLNSHRKYDYVEML--- 255
              |...||:..:|.:::     .::..|..|....|:....|.|:       ...::::.:|   
Zfish   304 TSDAAMILRNCVKIEQLVDPLPAVEAILRRCNKMQIIDHYGIPDF-------QTAHEFLALLARR 361

  Fly   256 --KLSSG--PSDDISA--VLAEYAHREELFHKVKQYDGRVEVMTN 294
              ||..|  |..|.:|  ||.::.            .||:...|:
Zfish   362 QGKLRKGGLPDSDKAAKSVLMDWT------------GGRISYFTH 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17141NP_651094.2 GTPase_YlqF 20..317 CDD:274669 79/305 (26%)
YlqF 22..206 CDD:206749 59/201 (29%)
gnl3lNP_001002875.1 GN3L_Grn1 2..69 CDD:285863
RbgA 92..397 CDD:224083 79/305 (26%)
Nucleostemin_like 127..298 CDD:206753 56/178 (31%)
P-loop_NTPase 249..357 CDD:304359 32/119 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.