DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17141 and CG10914

DIOPT Version :9

Sequence 1:NP_651094.2 Gene:CG17141 / 42697 FlyBaseID:FBgn0039020 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_611297.3 Gene:CG10914 / 37075 FlyBaseID:FBgn0034307 Length:624 Species:Drosophila melanogaster


Alignment Length:236 Identity:53/236 - (22%)
Similarity:90/236 - (38%) Gaps:75/236 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PGHMTKGM--RQIQQKLRNVDC----IVEIHDARIPLAGRNSQFFDTITG--------------- 67
            ||::...:  .:.||:|:.:.|    .:..::..:.:....|.:.|||:.               
  Fly   124 PGYIPSEIFRDRTQQELQTITCKRCHFLNHYNIALDVVVAPSTYVDTISRIQDKFALAIVLVDLL 188

  Fly    68 --------------SGVKPHILVLNKVDLLGAKQQKSVLQQLRRQQPELQHILFTNCKD--QR-- 114
                          ...:|..||.||||||.           |.....||||     ||  ||  
  Fly   189 DFPCSIWPGMQNILGAKRPVFLVGNKVDLLP-----------RDSNIYLQHI-----KDSLQREF 237

  Fly   115 -----NNGV----LDILPLATRLVSES--SRFNRTQAAEHNLMIIGVPNVGKSSVINVLRNVHLK 168
                 .||:    :.::...|....|.  ::.::|.|.:.::.::|..||||||:.|:|.|....
  Fly   238 IKHGGGNGLNIKNVSLISAKTGYGIEELITQLHKTWAYKGDVYLVGCTNVGKSSLFNILLNSDYC 302

  Fly   169 KKSAARVGAEAGITRSVGERIKIQENPPVYMIDTPGILQPS 209
            :..|:.:..:|......|..:|:...|         ||:||
  Fly   303 RPEASDLVRKATTCPWPGTTLKLLRFP---------ILRPS 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17141NP_651094.2 GTPase_YlqF 20..317 CDD:274669 53/236 (22%)
YlqF 22..206 CDD:206749 49/231 (21%)
CG10914NP_611297.3 GTPase_YqeH 109..596 CDD:213834 53/236 (22%)
YqeH 145..332 CDD:206748 45/211 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435338
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.