DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17141 and lsg1

DIOPT Version :9

Sequence 1:NP_651094.2 Gene:CG17141 / 42697 FlyBaseID:FBgn0039020 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_997807.1 Gene:lsg1 / 323464 ZFINID:ZDB-GENE-030131-2184 Length:640 Species:Danio rerio


Alignment Length:400 Identity:82/400 - (20%)
Similarity:134/400 - (33%) Gaps:142/400 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RNAFRLPSKQRINWFPGHMTKGM-RQIQQKLRNVDCIVEIHDARIPLAGRNSQFFDTITGSGV-K 71
            |:..||..:|::...|....... ||:.:.:...|.:|:|.|||.||..|.......:....| |
Zfish   142 RDLARLEEEQKLILTPFERNLDFWRQLWRVIERSDVVVQIVDARNPLLFRCPDLEKYVKEVSVHK 206

  Fly    72 PHILVLNKVDLLGAKQQK----------------SVLQQLRRQQPE------------------- 101
            .::|:|||.|||..:|::                |.|.:.:|.:.|                   
Zfish   207 VNMLLLNKADLLTREQRRAWARYFQKEGIRAVFWSALAEAQRLEAEERGEDAMDQEDQSDTEEET 271

  Fly   102 -------------------------------------LQHILFTNCKDQRNNGVLDILPLATRLV 129
                                                 :....:..|.::  :|..|.........
Zfish   272 ASKNATDHHEENSSSPNEEKDENEQDEEEEGEDERICVDESEWQTCSEE--SGDEDHAEENPEST 334

  Fly   130 SESSRFNRTQAAEHNLM---------------------IIGVPNVGKSSVIN-VLRNVHLKKKSA 172
            :.||.:|.::....|.:                     ::|.|||||||.|| :.||   ||.| 
Zfish   335 ATSSFYNSSRLLRKNELLEMFKSVHSGPTCKDGQITVGLVGYPNVGKSSTINTIFRN---KKVS- 395

  Fly   173 ARVGAEAGITRSVGERIKIQENPPVYMIDTPGILQPSIKDDEMGMKLALVGCLP-----DHIVGE 232
              |.|..|.|:.. :.:.::  |.:.:.|.||::.||....:..|..:  |.||     ||:...
Zfish   396 --VSATPGHTKHF-QTLFVE--PGLCLCDCPGLVMPSFVSTKAEMICS--GILPIDQMRDHVPAI 453

  Fly   233 DLIADYL-------LYWLNSHR------------------KYDYVEMLKLSSG-PSDDISA--VL 269
            .|:...:       .|.:|..|                  .|.|:.....:.| |....||  ||
Zfish   454 SLVCQNIPRNVLEGTYGINIIRPREDEDPDRPPTYEELLMAYGYMRGFMTAHGQPDQSRSARYVL 518

  Fly   270 AEYAHREELF 279
            .:|...:.|:
Zfish   519 KDYVSGKLLY 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17141NP_651094.2 GTPase_YlqF 20..317 CDD:274669 78/388 (20%)
YlqF 22..206 CDD:206749 56/279 (20%)
lsg1NP_997807.1 RbgA 152..534 CDD:224083 78/389 (20%)
HSR1_MMR1 164..426 CDD:206750 55/272 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 251..341 6/91 (7%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 602..640
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.