Sequence 1: | NP_651094.2 | Gene: | CG17141 / 42697 | FlyBaseID: | FBgn0039020 | Length: | 323 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_997807.1 | Gene: | lsg1 / 323464 | ZFINID: | ZDB-GENE-030131-2184 | Length: | 640 | Species: | Danio rerio |
Alignment Length: | 400 | Identity: | 82/400 - (20%) |
---|---|---|---|
Similarity: | 134/400 - (33%) | Gaps: | 142/400 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 RNAFRLPSKQRINWFPGHMTKGM-RQIQQKLRNVDCIVEIHDARIPLAGRNSQFFDTITGSGV-K 71
Fly 72 PHILVLNKVDLLGAKQQK----------------SVLQQLRRQQPE------------------- 101
Fly 102 -------------------------------------LQHILFTNCKDQRNNGVLDILPLATRLV 129
Fly 130 SESSRFNRTQAAEHNLM---------------------IIGVPNVGKSSVIN-VLRNVHLKKKSA 172
Fly 173 ARVGAEAGITRSVGERIKIQENPPVYMIDTPGILQPSIKDDEMGMKLALVGCLP-----DHIVGE 232
Fly 233 DLIADYL-------LYWLNSHR------------------KYDYVEMLKLSSG-PSDDISA--VL 269
Fly 270 AEYAHREELF 279 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17141 | NP_651094.2 | GTPase_YlqF | 20..317 | CDD:274669 | 78/388 (20%) |
YlqF | 22..206 | CDD:206749 | 56/279 (20%) | ||
lsg1 | NP_997807.1 | RbgA | 152..534 | CDD:224083 | 78/389 (20%) |
HSR1_MMR1 | 164..426 | CDD:206750 | 55/272 (20%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 251..341 | 6/91 (7%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 602..640 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |