Sequence 1: | NP_651094.2 | Gene: | CG17141 / 42697 | FlyBaseID: | FBgn0039020 | Length: | 323 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_997665.1 | Gene: | Gnl1 / 309593 | RGDID: | 1303051 | Length: | 607 | Species: | Rattus norvegicus |
Alignment Length: | 286 | Identity: | 57/286 - (19%) |
---|---|---|---|
Similarity: | 102/286 - (35%) | Gaps: | 91/286 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 SKQRINWFPGHMTKGMRQIQQKLRNVDCIVEIHDARIPLAGRNSQFFDTITGSGVKPHILVLNKV 80
Fly 81 DLLGAKQQKSVLQQLRRQQPELQHILFTN------------------------------------ 109
Fly 110 -C--------------------------------KDQRNNGVLDILPLATRLVSESSRFNRTQAA 141
Fly 142 EHNLMI--IGVPNVGKSSVINVLRNVHLKKKSAARVGAE-AGITRSVGERIKIQE---NPPVYMI 200
Fly 201 DTPGILQPSIKDDEMGMKLALVGCLP 226 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17141 | NP_651094.2 | GTPase_YlqF | 20..317 | CDD:274669 | 57/282 (20%) |
YlqF | 22..206 | CDD:206749 | 52/258 (20%) | ||
Gnl1 | NP_997665.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..81 | ||
HSR1_MMR1 | 177..418 | CDD:206750 | 50/252 (20%) | ||
rbgA | 179..516 | CDD:236570 | 55/270 (20%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 544..607 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1161 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |