DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17141 and Gnl3

DIOPT Version :9

Sequence 1:NP_651094.2 Gene:CG17141 / 42697 FlyBaseID:FBgn0039020 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_783170.1 Gene:Gnl3 / 290556 RGDID:631354 Length:538 Species:Rattus norvegicus


Alignment Length:283 Identity:71/283 - (25%)
Similarity:126/283 - (44%) Gaps:56/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 QKLRNV----DCIVEIHDARIPLAGRNSQFFDTITGSGVKPHILVLNKVDLLGAKQQKSVLQQLR 96
            |:|:.|    |.::|:.|||.||..|..|..:.:..||.|..:|||||.||:..:..::.|..|.
  Rat   130 QELKKVIEASDIVLEVLDARDPLGCRCPQVEEAVIQSGCKKLVLVLNKSDLVPKENLENWLTYLN 194

  Fly    97 RQQPELQHILFTNCKDQRNNGVL--DILPLATRLVSESSR-------FNRTQAAEHNLMIIGVPN 152
            ::.|.:.....||.|:::....:  .::|..::|......       |.::......:.::|.||
  Rat   195 KELPTVVFKASTNLKNRKKTFKIKKKVVPFQSKLCCGKEALWKLLGGFQQSCGKGVQVGVVGFPN 259

  Fly   153 VGKSSVINVLRNVHLKKKSAARVGAEAGITRSVGERIKIQENPPVYMIDTPGILQPSIKDDEMGM 217
            |||||:||     .||::....||...|:|||: :.:.:.:.  :.:||:|..:   |.......
  Rat   260 VGKSSIIN-----SLKQERICSVGVSMGLTRSM-QIVPLDKQ--ITIIDSPCFI---ISPCNSPA 313

  Fly   218 KLALVGCLPDHIVGEDLIADYLLYWLNSHRKYDYVEMLKLSSGPSDDISAVLAEY-AHREELFHK 281
            .|||                         |....:|:|:    |.:..||:|::. :.:..|.:.
  Rat   314 ALAL-------------------------RSPASIEVLR----PLEAASAILSQADSQQVVLKYT 349

  Fly   282 VKQYDGRVEVMTNLLAAARKFIH 304
            |..|...::..|.|  |.|:.:|
  Rat   350 VPGYKDSLDFFTKL--AQRRGLH 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17141NP_651094.2 GTPase_YlqF 20..317 CDD:274669 71/283 (25%)
YlqF 22..206 CDD:206749 52/182 (29%)
Gnl3NP_783170.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..125
Basic 2..46
GN3L_Grn1 16..93 CDD:285863
RbgA 125..420 CDD:224083 71/283 (25%)
Nucleostemin_like 140..302 CDD:206753 48/169 (28%)
Intermediate 277..451 28/131 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 460..538
Acidic 460..532
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.