DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17141 and Noa1

DIOPT Version :9

Sequence 1:NP_651094.2 Gene:CG17141 / 42697 FlyBaseID:FBgn0039020 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_006250907.1 Gene:Noa1 / 289562 RGDID:1359460 Length:694 Species:Rattus norvegicus


Alignment Length:252 Identity:55/252 - (21%)
Similarity:86/252 - (34%) Gaps:81/252 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 IVEIHDARIPLAGRNSQFFDTITGSGVKPHILVLNKVDLLGAKQQKSVLQQLRR----------- 97
            ::::.||.:|         |.....|.|...::.|||||| .:.....||:||:           
  Rat   224 LLDLPDALLP---------DLPKLVGPKQLFVLGNKVDLL-PQDAPGYLQRLRKRLWNDCIRAGL 278

  Fly    98 ---------QQP----ELQHILFTNCKDQRNNGVLDILPLATRLVSES---------SRFNRTQA 140
                     |.|    .|..|...|...:....|.|:     ||:|..         |...|:..
  Rat   279 VVAPGHRGPQYPTGNEPLDEIKNQNPSSRSRTVVKDV-----RLISAKTGYGVEELISALQRSWR 338

  Fly   141 AEHNLMIIGVPNVGKSSVINVLRNVHLKKKSAARVGAEAGITRSV-----GERIKIQENP----- 195
            ...::.::|..|.|||::.|.|    |:.......|:|| |.|:.     |..:.:.:.|     
  Rat   339 YRGDVYLVGTTNAGKSTLFNTL----LESDYCTAKGSEA-IDRATISPWPGTTLNLLKFPICNPT 398

  Fly   196 PVYMIDTPGILQPSIKDDEMGMKLALVGCLPDHIVGEDLIADYLLYWLNSHRKYDYV 252
            |..|......||......|                 ||| ::.....||..:|:.|:
  Rat   399 PYRMFKRQKRLQEDASKTE-----------------EDL-SEQEQSQLNQLKKHGYI 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17141NP_651094.2 GTPase_YlqF 20..317 CDD:274669 55/252 (22%)
YlqF 22..206 CDD:206749 45/204 (22%)
Noa1XP_006250907.1 PRK13796 140..656 CDD:237511 55/252 (22%)
YqeH 180..396 CDD:206748 43/191 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.