Sequence 1: | NP_651094.2 | Gene: | CG17141 / 42697 | FlyBaseID: | FBgn0039020 | Length: | 323 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_005266.2 | Gene: | GNL1 / 2794 | HGNCID: | 4413 | Length: | 607 | Species: | Homo sapiens |
Alignment Length: | 286 | Identity: | 58/286 - (20%) |
---|---|---|---|
Similarity: | 99/286 - (34%) | Gaps: | 91/286 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 SKQRINWFPGHMTKGMRQIQQKLRNVDCIVEIHDARIPLAGRNSQFFDTITGSGVKPHILVLNKV 80
Fly 81 DLLGAKQQKSVLQQLRRQQPELQHILFTNC---------------KDQRNN-------------- 116
Fly 117 -------GVLDILPLATRLVSE----------------------------SSRFNRTQAAEH--- 143
Fly 144 ----NLMIIGVPNVGKSSVINVLRNVHLKKKSAARVGAE-AGITRSVGERIKIQE---NPPVYMI 200
Fly 201 DTPGILQPSIKDDEMGMKLALVGCLP 226 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17141 | NP_651094.2 | GTPase_YlqF | 20..317 | CDD:274669 | 57/282 (20%) |
YlqF | 22..206 | CDD:206749 | 52/258 (20%) | ||
GNL1 | NP_005266.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..81 | ||
RbgA | 170..514 | CDD:331156 | 57/280 (20%) | ||
HSR1_MMR1 | 177..418 | CDD:206750 | 50/252 (20%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 547..607 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1161 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |