DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17141 and GNL1

DIOPT Version :9

Sequence 1:NP_651094.2 Gene:CG17141 / 42697 FlyBaseID:FBgn0039020 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_005266.2 Gene:GNL1 / 2794 HGNCID:4413 Length:607 Species:Homo sapiens


Alignment Length:286 Identity:58/286 - (20%)
Similarity:99/286 - (34%) Gaps:91/286 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SKQRINWFPGHMTKGMRQIQQKLRNVDCIVEIHDARIPLAGRNSQFFDTITGSGVKPHILVLNKV 80
            |.:::::|. |..:..||:.:.|...|.::.|.|.|.|:.......::.:||......:||||||
Human   164 SSEKLSYFE-HNLETWRQLWRVLEMSDIVLLITDIRHPVVNFPPALYEYVTGELGLALVLVLNKV 227

  Fly    81 DLLGAKQQKSVLQQLRRQQPELQHILFTNC---------------KDQRNN-------------- 116
            ||.......:......:..|:|..:|||:.               |.:|..              
Human   228 DLAPPALVVAWKHYFHQHYPQLHVVLFTSFPRDPRTPQDPSSVLKKSRRRGRGWTRALGPEQLLR 292

  Fly   117 -------GVLDILPLATRLVSE----------------------------SSRFNRTQAAEH--- 143
                   |.:|:.....::..:                            .|....|...:.   
Human   293 ACEAITVGKVDLSSWREKIARDVAGATWGNGSGEEEEEEDGPAVLVEQQTDSAMEPTGPTQERYK 357

  Fly   144 ----NLMIIGVPNVGKSSVINVLRNVHLKKKSAARVGAE-AGITRSVGERIKIQE---NPPVYMI 200
                .:..:|.|||||||:||.|            ||.: ..::|:.|.....|.   .|.|.:.
Human   358 DGVVTIGCVGFPNVGKSSLINGL------------VGRKVVSVSRTPGHTRYFQTYFLTPSVKLC 410

  Fly   201 DTPGILQPSIKDDEMGMKLALVGCLP 226
            |.||::.||:...::.:   |.|..|
Human   411 DCPGLIFPSLLPRQLQV---LAGIYP 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17141NP_651094.2 GTPase_YlqF 20..317 CDD:274669 57/282 (20%)
YlqF 22..206 CDD:206749 52/258 (20%)
GNL1NP_005266.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..81
RbgA 170..514 CDD:331156 57/280 (20%)
HSR1_MMR1 177..418 CDD:206750 50/252 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 547..607
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.