DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17141 and Gnl3l

DIOPT Version :9

Sequence 1:NP_651094.2 Gene:CG17141 / 42697 FlyBaseID:FBgn0039020 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001162071.1 Gene:Gnl3l / 237107 MGIID:2448557 Length:577 Species:Mus musculus


Alignment Length:226 Identity:68/226 - (30%)
Similarity:98/226 - (43%) Gaps:60/226 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QRINWFPGHMTKGMRQIQQK-LRNV----DCIVEIHDARIPLAGRNSQFFDTI-TGSGVKPHILV 76
            |.:|.||....:..|:...| .|.|    |.|:|:.|||.||..|..|..:|: ...|.|..:||
Mouse   100 QELNMFPQLDDEATRKAYYKEFRKVVEYSDVILEVLDARDPLGCRCFQMEETVLRAEGNKKLVLV 164

  Fly    77 LNKVDLLGAKQQKSVLQQLRRQQPEL------QHIL---FTNCK---DQRNNGVLDILPLATRLV 129
            |||:||:..:..:..|:.|..:.|.:      ||..   .|.||   ||               .
Mouse   165 LNKIDLVPKEIVEKWLEYLLNELPTVAFKASTQHHQVKNLTRCKVPVDQ---------------A 214

  Fly   130 SESSRFNRTQAAEHNLM-------------------IIGVPNVGKSSVINVLRNVHLKKKSAARV 175
            |||...:|......|||                   ::|:|||||||:||     .||:..|..|
Mouse   215 SESLLKSRACFGAENLMRVLGNYCRLGEVRGHIRVGVVGLPNVGKSSLIN-----SLKRSRACSV 274

  Fly   176 GAEAGITRSVGERIKIQENPPVYMIDTPGIL 206
            ||..|:|:.:.|   :..:..:.::|.|||:
Mouse   275 GAVPGVTKFMQE---VYLDKFIRLLDAPGIV 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17141NP_651094.2 GTPase_YlqF 20..317 CDD:274669 67/224 (30%)
YlqF 22..206 CDD:206749 65/220 (30%)
Gnl3lNP_001162071.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..75
Required for nucleolar localization. /evidence=ECO:0000250 9..28
PTZ00121 <19..166 CDD:173412 23/65 (35%)
Nucleostemin_like 129..301 CDD:206753 58/194 (30%)
GTP1 246..>384 CDD:223091 23/65 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.