DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17141 and Lsg1

DIOPT Version :9

Sequence 1:NP_651094.2 Gene:CG17141 / 42697 FlyBaseID:FBgn0039020 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_036015788.1 Gene:Lsg1 / 224092 MGIID:107236 Length:650 Species:Mus musculus


Alignment Length:439 Identity:84/439 - (19%)
Similarity:148/439 - (33%) Gaps:172/439 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RNAFRLPSKQRINWFPGHMTKGM-RQIQQKLRNVDCIVEIHDARIPLAGRNSQ---FFDTITGSG 69
            |...||..:|::...|....... ||:.:.:...|.:|:|.|||.||..|...   :...|  ..
Mouse   147 RQLVRLEEEQKLILTPFERNLDFWRQLWRVIERSDIVVQIVDARNPLLFRCEDLECYVKEI--DA 209

  Fly    70 VKPHILVLNKVDLLGAKQQKSVLQQLRRQ--------------------QPELQHILFTNCKDQR 114
            .|.:::::||.|||.|:|:.:......::                    :.|:..:.....|.:.
Mouse   210 AKENVILINKADLLTAEQRFAWAVHFEKEGVKVIFWSALAETDHLNGDLKEEVDSVAGDTNKTES 274

  Fly   115 NNGVL--------DILPLATRLVSES--SRF---------------------------------- 135
            .:..|        |::.|:....|:|  |::                                  
Mouse   275 ESSSLDANEIPHRDLISLSEESASDSGDSKYEDCQEDEEEDWQTCSEEDSVPEEEEGCNADSETQ 339

  Fly   136 NRTQA------------AEHNLM--------------------IIGVPNVGKSSVIN-VLRNVHL 167
            ||..|            ::..|:                    ::|.|||||||.|| ::.|   
Mouse   340 NRKNAENQQVNNDSYLVSKQELLELFKKLHTGKKVKDGQLTVGLVGYPNVGKSSTINTIMGN--- 401

  Fly   168 KKKSAARVGAEAGITRSVGERIKIQENPPVYMIDTPGILQPSIKDDEMGMKLALV--GCLP---- 226
            ||.|   |.|..|.|:.. :.:.::  |.:.:.|.||::.||.    :..|..::  |.||    
Mouse   402 KKVS---VSATPGHTKHF-QTLYVE--PGLCLCDCPGLVMPSF----VSTKAEMICNGILPIDQM 456

  Fly   227 -DHI------------------------------------VGEDLIADY--LLYWLNSH------ 246
             ||:                                    ..|:|:..|  :..::.:|      
Mouse   457 RDHVPPVSLVCQNIPRRVLEVTYGINIIKPREDEDPYRPPTSEELLTAYGCMRGFMTAHGQPDQP 521

  Fly   247 --RKY---DYVEMLKLSSGPSDDISAVLAEYAHREELFHKVKQYDGRVE 290
              .:|   |||....|...|......|..::.|::.|..|||..:.|::
Mouse   522 RSARYILKDYVGGKLLYCHPPPGKDPVAFQHQHQQLLESKVKGGELRLQ 570

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17141NP_651094.2 GTPase_YlqF 20..317 CDD:274669 80/428 (19%)
YlqF 22..206 CDD:206749 55/284 (19%)
Lsg1XP_036015788.1 RbgA 157..546 CDD:224083 73/403 (18%)
HSR1_MMR1 169..436 CDD:206750 54/277 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.