DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17141 and Gnl1

DIOPT Version :9

Sequence 1:NP_651094.2 Gene:CG17141 / 42697 FlyBaseID:FBgn0039020 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_036016217.1 Gene:Gnl1 / 14670 MGIID:95764 Length:730 Species:Mus musculus


Alignment Length:286 Identity:58/286 - (20%)
Similarity:102/286 - (35%) Gaps:91/286 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SKQRINWFPGHMTKGMRQIQQKLRNVDCIVEIHDARIPLAGRNSQFFDTITGSGVKPHILVLNKV 80
            :.:::::|. |..:..||:.:.|...|.::.|.|.|.|:.......::.:||......:||||||
Mouse   287 TSEKLSYFE-HNLETWRQLWRVLEMSDIVLLITDIRHPVVNFPPALYEYVTGELGLALVLVLNKV 350

  Fly    81 DLLGAKQQKSVLQQLRRQQPELQHILFTN------------------------------------ 109
            ||.......:......:..|:|..:|||:                                    
Mouse   351 DLAPPALVVAWKHYFHQCYPQLHIVLFTSFPRDTRTPQEPGGVLKKNRRRGKGWTRALGPEQLLR 415

  Fly   110 -C--------------------------------KDQRNNGVLDILPLATRLVSESSRFNRTQAA 141
             |                                :::..:|...::...|....|.:..:|.:..
Mouse   416 ACEAITVGKVDLSSWREKIARDVAGASWGNVSGEEEEEEDGPAVLVEQLTDSAMEPTGPSRERYK 480

  Fly   142 EHNLMI--IGVPNVGKSSVINVLRNVHLKKKSAARVGAE-AGITRSVGERIKIQE---NPPVYMI 200
            :..:.|  ||.|||||||:||.|            ||.: ..::|:.|.....|.   .|.|.:.
Mouse   481 DGVVTIGCIGFPNVGKSSLINGL------------VGRKVVSVSRTPGHTRYFQTYFLTPSVKLC 533

  Fly   201 DTPGILQPSIKDDEMGMKLALVGCLP 226
            |.||::.||:...::.:   |.|..|
Mouse   534 DCPGLIFPSLLPRQLQV---LAGIYP 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17141NP_651094.2 GTPase_YlqF 20..317 CDD:274669 58/282 (21%)
YlqF 22..206 CDD:206749 53/258 (21%)
Gnl1XP_036016217.1 RbgA 293..637 CDD:224083 58/280 (21%)
HSR1_MMR1 300..541 CDD:206750 51/252 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.