Sequence 1: | NP_651094.2 | Gene: | CG17141 / 42697 | FlyBaseID: | FBgn0039020 | Length: | 323 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_036016217.1 | Gene: | Gnl1 / 14670 | MGIID: | 95764 | Length: | 730 | Species: | Mus musculus |
Alignment Length: | 286 | Identity: | 58/286 - (20%) |
---|---|---|---|
Similarity: | 102/286 - (35%) | Gaps: | 91/286 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 SKQRINWFPGHMTKGMRQIQQKLRNVDCIVEIHDARIPLAGRNSQFFDTITGSGVKPHILVLNKV 80
Fly 81 DLLGAKQQKSVLQQLRRQQPELQHILFTN------------------------------------ 109
Fly 110 -C--------------------------------KDQRNNGVLDILPLATRLVSESSRFNRTQAA 141
Fly 142 EHNLMI--IGVPNVGKSSVINVLRNVHLKKKSAARVGAE-AGITRSVGERIKIQE---NPPVYMI 200
Fly 201 DTPGILQPSIKDDEMGMKLALVGCLP 226 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17141 | NP_651094.2 | GTPase_YlqF | 20..317 | CDD:274669 | 58/282 (21%) |
YlqF | 22..206 | CDD:206749 | 53/258 (21%) | ||
Gnl1 | XP_036016217.1 | RbgA | 293..637 | CDD:224083 | 58/280 (21%) |
HSR1_MMR1 | 300..541 | CDD:206750 | 51/252 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1161 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |