DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17141 and Mtg1

DIOPT Version :9

Sequence 1:NP_651094.2 Gene:CG17141 / 42697 FlyBaseID:FBgn0039020 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_006230646.1 Gene:Mtg1 / 100910751 RGDID:6497155 Length:331 Species:Rattus norvegicus


Alignment Length:319 Identity:142/319 - (44%)
Similarity:202/319 - (63%) Gaps:18/319 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FRNAFRLPSKQRINWFPGHMTKGMRQIQQKLRNVDCIVEIHDARIPLAGRNSQFFDTITGSGVKP 72
            :|..|.|.......||||||.||::::|..|:.|||::|:||||||.:|||..|.:.:   |:||
  Rat    15 WRECFPLQGHDVARWFPGHMAKGLKKMQSSLKLVDCVIEVHDARIPFSGRNPLFQELL---GLKP 76

  Fly    73 HILVLNKVDLLGAKQQKSVLQQLRRQQPELQHILFTNC-KDQRNNGVLDILPLATRLVSESSRFN 136
            |:|||||:||....:|:.::|.|  ::..|::::|||| ||:   .:..|:|..|.|:..|.|::
  Rat    77 HLLVLNKMDLADLTEQQKIVQHL--EEKGLRNVIFTNCIKDE---NIKQIIPKVTELIGCSYRYH 136

  Fly   137 RTQAAEHNLMIIGVPNVGKSSVINVLRNVHLKKKSAARVGAEAGITRSVGERIKIQENPPVYMID 201
            |.:..|:.:|::|||||||||:||.||..||:...|||||.|.||||:|..||::.|.|.::::|
  Rat   137 RAENPEYCIMVVGVPNVGKSSLINSLRRQHLRTGKAARVGGEPGITRAVTSRIQVCERPLMFLLD 201

  Fly   202 TPGILQPSIKDDEMGMKLA-----LVGCLPDHIVGEDLIADYLLYWLNSHRKYDYVEMLKLSSGP 261
            |||:|.|.|:..|.|:|||     |.|.:.||:|||:.:||||||.||.|..:.||:...|:|. 
  Rat   202 TPGVLAPRIQSVETGLKLALCAACLAGTVLDHLVGEETMADYLLYTLNRHGLFGYVQHYALASA- 265

  Fly   262 SDDISAVLAEYAHREELFHKVKQYDGRVEV---MTNLLAAARKFIHFFRSGQLGHMNLD 317
            ||.|..||...|.:.....|||...|...|   ..:...|||.|:..||||:||.:.||
  Rat   266 SDHIEWVLKNVAIKLGKTRKVKVLTGTGNVNVIQPDYAIAARDFLRTFRSGRLGQVMLD 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17141NP_651094.2 GTPase_YlqF 20..317 CDD:274669 137/305 (45%)
YlqF 22..206 CDD:206749 88/184 (48%)
Mtg1XP_006230646.1 GTPase_YlqF 29..324 CDD:274669 137/303 (45%)
YlqF 29..206 CDD:206749 88/184 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338118
Domainoid 1 1.000 122 1.000 Domainoid score I5522
eggNOG 1 0.900 - - E1_COG1161
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H44527
Inparanoid 1 1.050 262 1.000 Inparanoid score I3021
OMA 1 1.010 - - QHG58595
OrthoDB 1 1.010 - - D511272at33208
OrthoFinder 1 1.000 - - FOG0003800
OrthoInspector 1 1.000 - - oto97547
orthoMCL 1 0.900 - - OOG6_101533
Panther 1 1.100 - - LDO PTHR45782
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3162
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.