DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1c and CDYL

DIOPT Version :9

Sequence 1:NP_651093.1 Gene:HP1c / 42696 FlyBaseID:FBgn0039019 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001355054.1 Gene:CDYL / 9425 HGNCID:1811 Length:598 Species:Homo sapiens


Alignment Length:285 Identity:66/285 - (23%)
Similarity:97/285 - (34%) Gaps:123/285 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PNFVVERIMDKRITSEGKVEYYIKWRGYTSADNTWEPEE---NCD-------------------- 47
            |...||||:|||...:||.||.::|:||.|.|:|||||:   ||:                    
Human    59 PALQVERIVDKRKNKKGKTEYLVRWKGYDSEDDTWEPEQHLVNCEEYIHDFNRRHTEKQKESTLT 123

  Fly    48 -----CPNLIQKFEESRAKSKKRGEKKPKCEEI---------------QKLR-------GYERGL 85
                 .||..:| :.||:.:....:..||...|               ||.|       ...:.:
Human   124 RTNRTSPNNARK-QISRSTNSNFSKTSPKALVIGKDHESKNSQLFAASQKFRKNTAPSLSSRKNM 187

  Fly    86 ELAEIVGATDVTGDIKYLVRWQFCDEFDLVPSAQIVEKDPQMLIDYFQKMAPYSRHIAMRMKGVP 150
            :||:        ..||.           |||.:.:..:   ..:|.||..:             |
Human   188 DLAK--------SGIKI-----------LVPKSPVKSR---TAVDGFQSES-------------P 217

  Fly   151 EELRLAASRTSYPHISSAPVE------VPPEVDQSAELAGHLG--------GIAPQVDQ-APQHH 200
            |:|              .|||      |.|||.....:...||        |..|::.. .||..
Human   218 EKL--------------DPVEQGQEDTVAPEVAAEKPVGALLGPGAERARMGSRPRIHPLVPQVP 268

  Fly   201 APMDLANDTDDLASVSYSIPVPGVG 225
            .|:        .|:::..:.|.|.|
Human   269 GPV--------TAAMATGLAVNGKG 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1cNP_651093.1 Chromo 9..58 CDD:278797 26/76 (34%)
Chromo_shadow 89..134 CDD:279701 7/44 (16%)
CDYLNP_001355054.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..76 8/16 (50%)
Interaction with EZH2. /evidence=ECO:0000269|PubMed:22009739 61..309 65/283 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..149 5/37 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..226 9/51 (18%)
Acetyl-CoA-binding domain. /evidence=ECO:0000255 362..594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R201
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.