DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1c and cbx8b

DIOPT Version :9

Sequence 1:NP_651093.1 Gene:HP1c / 42696 FlyBaseID:FBgn0039019 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001019586.1 Gene:cbx8b / 799361 ZFINID:ZDB-GENE-050522-325 Length:361 Species:Danio rerio


Alignment Length:314 Identity:73/314 - (23%)
Similarity:107/314 - (34%) Gaps:98/314 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FVVERIMDKRITSEGKVEYYIKWRGYTSADNTWEPEENCDCPNLIQKFEESRAK-----SKKRGE 67
            |..|.|:.:|| ..|.:||.:||:|::...:|||||||...|.|...|||...:     .||||.
Zfish    11 FAAESIIKRRI-RRGHMEYLVKWKGWSPKYSTWEPEENILDPRLFVAFEEREREREIFGPKKRGP 74

  Fly    68 KKP----KCEEIQKLRGYE------RGLELA----EIVGATDVTGDIKYLVRWQF---------- 108
            |..    |.:..:|.:.||      ||:.:.    |.|.|......::.:|...|          
Zfish    75 KLKTFLLKAQAKEKAKSYEFRNDSSRGIHVTYSSPEPVVAPRAREGLRAVVPTIFPPSTVNRGES 139

  Fly   109 -------------------CDEFDLVPSAQIVEKDPQMLIDYFQKMAPYSRHIAM----RMKGVP 150
                               .|||.|.|..:..:...:....|...:.|  .|:..    .|..:|
Zfish   140 VRLQSPEPREHHSPHSPRPTDEFSLTPKKRGRKPKLRFTDGYTSNLHP--EHVKRAADETMASIP 202

  Fly   151 E---ELRLAASRTSYPHISS------------------------APVEVPPE--VDQSAELAGHL 186
            .   :|.|.......|.||.                        :.:.:.|:  :..|...||.|
Zfish   203 SKMAKLGLGEDDERCPDISGRLKISHKDLDATCSHKQSNVIPSRSTLHISPQWSLHSSRMEAGLL 267

  Fly   187 G-GIAPQVDQAPQHH-------APMDLANDTDDLASVSYSIPV------PGVGD 226
            | ...||.:...|.|       ..::..:.|....|:...|||      |||.|
Zfish   268 GHRTNPQSNHFHQKHLKHYSKKRTLEHGDSTSRQPSLIAKIPVSHIFREPGVED 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1cNP_651093.1 Chromo 9..58 CDD:278797 21/48 (44%)
Chromo_shadow 89..134 CDD:279701 11/73 (15%)
cbx8bNP_001019586.1 Chromo 14..57 CDD:278797 19/43 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.