DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1c and cbx6a

DIOPT Version :10

Sequence 1:NP_651093.1 Gene:HP1c / 42696 FlyBaseID:FBgn0039019 Length:237 Species:Drosophila melanogaster
Sequence 2:XP_073792856.1 Gene:cbx6a / 799294 ZFINID:ZDB-GENE-040808-26 Length:488 Species:Danio rerio


Alignment Length:69 Identity:28/69 - (40%)
Similarity:39/69 - (56%) Gaps:7/69 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FVVERIMDKRITSEGKVEYYIKWRGYTSADNTWEPEENCDCPNLIQKFEESRAKS-----KKRGE 67
            |..|.|:..|: .:|.:||.:||:|:....:|||||||.....||:.||:...:.     |||| 
Zfish    11 FAAEAILKSRV-RKGHIEYLVKWKGWALKHSTWEPEENILDDRLIKAFEQKEREQELYGPKKRG- 73

  Fly    68 KKPK 71
            .|||
Zfish    74 PKPK 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1cNP_651093.1 CD_CSD 8..55 CDD:475127 19/46 (41%)
CSD 85..135 CDD:349275
cbx6aXP_073792856.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.